KEGG   Candida dubliniensis: CD36_27190
Entry
CD36_27190        CDS       T01140                                 

Definition
(RefSeq) oligopeptide transporter, putative
Organism
cdu  Candida dubliniensis
SSDB
Motif
Pfam: OPT
Other DBs
NCBI-GeneID: 8049615
NCBI-ProteinID: XP_002421796
UniProt: B9WL35
Position
R:complement(481419..484133)
AA seq 904 aa
MDEKNPTELSVPNIEAVGSHLQVQDHEIDLQAITSNPLSIGQVATTLTESQKWFVLKRLH
FDALVSLEELPPQASFIFEKIEQMTTEEAVEILEKNIKEHETDVNIPENDLILWKELVER
SHKFTKVQLQEKLGNNSSSSLENERIGDVEQGHEIVDWDLQVRLEAVLVAYWSPYPEVRA
VTFPYDDPTIPAETFRVYLIAIIWTAIGAVINQFFAERRPAISLSMAVVQVFLYPSGILC
QWILPNWEFQIWKLTINLNPGPYTYKEQMLATIFCGVTGGGTSYVSSNILMQKSEIFYDN
KWVDFGYQVLLILSTNFLGVGLAGIMRKFAVYPTKAVWPSILPGLALNKTLLTPAKKEII
NGWKISGYNFFFIAFVASFLYFWIPDYLFQALSTFNWMTWIKPDNQNLAVITGSVGGLGL
NPITTFDWNYFSSMLQPLQVPFFYPVNNIIGMAIAFFCIIGVWYSNYKWTGYLPINDNGL
YTNTGEPYSVRSVVDTNSLFDKKKYAEMGPPFYTAANLVVYGAFFAIYPFHFVYELGMNY
DQMWDACKSFWRVIKDYKKSTYDGFDDPHSTMMKAYPEVPEWAYLIIVVISLVLAILCVK
VYPAETPVWGIFFALGINFIFLIPLTTIYARTGFAFGLNVLVELIVGYAIPGNGLALAFI
KALGYNIDGQAQNFVNDLKQGHYAKLPPRAVYRVQLLSIFISSFIQLGILNFQINGGIKD
YCEPGNTQKFTCPNSRTFYSASVLWGVIGPKRVFNGLYPILRWCFLIGFLIAFPCIAIKK
WGPRKYVKYFEPSIIIGGFLNYAPYNLSYYIPGLYVSYAFMSYIKRKYEAWWQKYTYVLS
TGLNAGIAFSSIIIFFAVMYHEKDINWWGNTVSYSGVDYGMTGWLNATVDAPDGYFGPRV
GHFP
NT seq 2715 nt   +upstreamnt  +downstreamnt
atggatgaaaaaaatccaaccgaattaagtgtgcccaacatagaagcagttggaagtcat
ttacaagtccaagatcatgaaattgatttacaagcaatcacatcaaatcctctttctatt
ggtcaagttgctaccacattaactgaatctcaaaaatggtttgttttgaaaagattacat
tttgatgccttagtgtcgttagaagaattacctcctcaagctagttttatatttgaaaaa
attgaacaaatgactactgaagaagctgttgaaatattagaaaaaaacattaaagagcat
gaaactgatgttaatataccagaaaatgatttaatcctttggaaagagttagttgaaagg
tctcataaatttaccaaagtccaattacaagaaaaattgggtaacaattcatcatcatct
ttggaaaatgaaagaattggggatgttgaacaaggtcatgaaattgttgattgggattta
caagtacgtttagaagcagtattggttgcttattggtctccataccctgaagttagagct
gttactttcccatacgatgatccaactattcctgctgaaacatttagagtttatttgatt
gcaattatttggacagcaattggtgctgtgattaatcaattttttgctgaaagaagacca
gcaatatctctttccatggcagttgtacaagttttcctttatccatctggaatactttgt
cagtggattttacctaattgggaatttcaaatttggaaattaactattaacttaaatccc
ggtccttacacatataaggaacaaatgttggctacgatattttgcggtgttactggaggt
ggaacttcttatgtttccagtaatattcttatgcaaaaatctgaaattttttacgacaac
aaatgggttgattttggatatcaagtattattgattttgtctaccaactttcttggtgtt
ggtcttgctggtatcatgagaaaatttgccgtgtaccctactaaagcggtttggccatcc
attttaccaggtttagcattaaataaaactttattaacccctgctaaaaaggaaataatc
aatggatggaaaatatccggttataattttttctttattgcatttgttgcctcatttctt
tatttttggatacctgactacttattccaagctttgtcaactttcaattggatgacatgg
atcaaaccagataaccaaaatcttgctgtaattactggttcagttggtggattaggtttg
aatccaataactacttttgattggaattatttcagttctatgcttcaaccacttcaagtt
ccattcttttatcctgttaataacattattggtatggcaattgcattcttttgtatcatt
ggtgtttggtattccaattataaatggacgggatatttaccaatcaatgataatggtctt
tataccaatactggtgaaccttattcagttagactggttgtcgataccaatagtttgttt
gataaaaaaaaatatgctgaaatgggcccaccattctatactgctgctaacttggttgta
tatggtgcgttctttgccatttatccattccattttgtttacgaacttggtatgaattat
gaccaaatgtgggatgcttgtaagtcgttttggagagtgattaaagactataaaaaatct
acctatgatggatttgatgatccccacagtaccatgatgaaagcatacccagaagttcca
gaatgggcttatttgattatcgttgttatttcattggtgttagcaattttgtgtgtcaaa
gtatatcctgccgaaactccagtgtggggtattttctttgcattggggatcaattttata
ttcttaattccattaaccaccatctatgccagaactggatttgctttcggattgaatgtc
ttggttgaattgattgttggttatgctatcccaggtaatgggttagcattagcatttata
aaggcattgggttacaacatcgacggtcaagcacagaattttgtcaatgatttgaaacaa
ggtcattacgctaaacttcctccaagagctgtttatcgtgttcaattgttatctattttc
atatcatcttttattcaattgggtatattaaacttccaaattaatggtggtattaaagat
tattgtgaacctggtaatactcaaaaattcacttgtccaaacagtagaactttctattca
gcatcagtattatggggtgttattggtccaaaaagagttttcaatgggttatatccaatt
ttaagatggtgtttcttaattggatttttaattgcattcccatgtattgctattaaaaaa
tggggtccaagaaaatatgtcaaatatttcgaaccctctattattatcgggggattctta
aactatgctccatataacttgtcatattacattcctggtctttatgtgtcatatgcattt
atgtcatatattaaaagaaaatacgaagcatggtggcaaaaatatacttatgttctttca
actggtttgaatgctggtattgccttttcatcaatcattattttctttgcagtaatgtat
catgaaaaagatattaattggtggggtaacacagttctgtattctggcgttgattatggt
atgacaggatggttgaatgccactgttgatgcaccagatggttattttggaccaagagtt
ggtcatttcccttag

DBGET integrated database retrieval system