KEGG   Candida dubliniensis: CD36_29840Help
Entry
CD36_29840        CDS       T01140                                 

Definition
(RefSeq) palmitoyl-protein hydrolase, putative
  KO
K01074  palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
cdu  Candida dubliniensis
Pathway
cdu00062  Fatty acid elongation
cdu01100  Metabolic pathways
cdu01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Lipid metabolism
   00062 Fatty acid elongation
    CD36_29840
Enzymes [BR:cdu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     CD36_29840
Lipid biosynthesis proteins [BR:cdu01004]
 Fatty acid synthase
  Component type
   CD36_29840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Palm_thioest DUF676 Lipase_2 Hydrolase_4
Motif
Other DBs
NCBI-GeneID: 8050125
NCBI-ProteinID: XP_002422009
UniProt: B9WLP8
Position
R:complement(980225..981232)
Genome map
AA seq 335 aa AA seqDB search
MAHARSTINLCSVDKRTTRMLLSNLLNVQQTILSLIPETNIDVSKNLAKPVLPNADDYRP
VVIWHGLGDNYNSSGIHKVHEILDSMYPGIYVHSIRLDENPSSDEQKSFFGDANRQIDEV
CKQLRNITELSKGFDSIGFSQGGVFLRGLIERCPLEVNNFITFGSPHLGVSELPLCKDRF
DWLCKQRNALLKKQVWRDSVQKRVVPAQYFRDPAHLDQYLEHSNYLADINNEWAERNATY
KKNFSKLNKLVLVSFTEDTTLVPKESSQFYDFDPEQKRSIPFLYTELYKNDYIGLKALYK
KNSVDFLSIKAEHMHIDEGFIKSIAQEYFGGKLGT
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggcgcacgccagatccacaataaacttgtgttcagttgacaaacgaaccacacgaatg
ctattactgaatttactcaacgtccaacaaactatacttctgttaataccagagacaaat
attgatgtgtccaaaaatttggcaaaacctgttttgccaaatgcagatgattacagacct
gtggtaatttggcatggtttaggtgacaactacaattcgtcgggaatacataaagttcat
gaaatattagacagcatgtatccaggaatatatgtccattcaatacggttagatgagaat
ccttcttctgatgaacaaaagtctttttttggagatgccaaccggcaaattgacgaggtg
tgcaaacaacttcggaatatcactgaattactgaaagggtttgattccattgggttttcc
caaggtggtgtttttttgagaggtttgatagaaagatgccccttggaagtgaacaatttt
ataacgtttggctctccgcatcttggtgtactggaactacctctatgcaaagaccggttt
gattggttatgcaaacagagaaatgccctattgaagaagcaagtttggcgtgatagtgtc
caaaagcgagttgtaccagcacagtattttagagatccagcacacctagaccaatactta
gagcattcaaattacttggcagatataaacaacgagtgggcggaaaggaatgcaacttac
aagaagaatttttccaaattaaataaattggtgttagttagtttcaccgaagataccact
cttgttcctaaagaaagttcccagttttatgatttcgacccggaacaaaagagaagcatt
ccttttctttatacagagctatacaagaatgattacattggattgaaagccctttacaaa
aagaattcagttgattttctatcaattaaagcagaacatatgcatattgatgagggtttc
attaaaagtattgcacaagagtattttggcgggaaattgggtacttaa

DBGET integrated database retrieval system