KEGG   Candida dubliniensis: CD36_32310Help
Entry
CD36_32310        CDS       T01140                                 

Definition
(RefSeq) succinyl-CoA ligase, beta subunit, mitochondrial precursor, putative
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
cdu  Candida dubliniensis
Pathway
cdu00020  Citrate cycle (TCA cycle)
cdu00640  Propanoate metabolism
cdu01100  Metabolic pathways
cdu01110  Biosynthesis of secondary metabolites
cdu01130  Biosynthesis of antibiotics
cdu01200  Carbon metabolism
Module
cdu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cdu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cdu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CD36_32310
   00640 Propanoate metabolism
    CD36_32310
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cdu04147]
    CD36_32310
Enzymes [BR:cdu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     CD36_32310
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CD36_32310
Exosome [BR:cdu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CD36_32310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-GeneID: 8049523
NCBI-ProteinID: XP_002422190
UniProt: B9WM81
Position
R:complement(join(1430519..1431733,1432090..1432122))
Genome map
AA seq 415 aa AA seqDB search
MLSRSFARISRSAAQQKRFLSLHEYRSAALLSEYGVPIPKGYPATTPEGAYDAAKKLGTN
ELVIKAQALTGGRGKGHFDSGLQGGVKLISSAEEAKDLASQMLNHKLITKQTGAAGKEVT
AVYIVERRDAASEAYVAILMDRARQTPVIVASAQGGMDIEGVAAKDPSAIKTFPVPLEEG
VSDSLATEIAGALGFTQDAIPEAAKTIQSLYKCFIERDCTQVEINPLSETPDHKVLAMDA
KLGFDDNASFRQEEVFSWRDPTQEDPQEAEASKYGLNFIKLDGNIANIVNGAGLAMATMD
IIKLYGGEPANFLDCGGTATPETIEKAFELILSDPKVNGIFVNIFGGIVRCDYVAKGLIA
ATKNFKLDIPVVVRLQGTNLAEAKELIENSGLKLYAFEDLDPAAEKIVQLAPKNN
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcaagatcatttgcccgtatttcaagatctgctgctcaacaaaagagatttttg
tctttgcatgaataccgttccgccgctttattgagcgaatacggtgttccaattccaaaa
ggttacccagccaccactccagaaggcgcttatgatgctgccaaaaagttgggtaccaat
gaattagttatcaaagcacaagctttaactggtggtcgtggtaaaggtcactttgactct
ggtttgcaaggtggtgttaaattgatctcttccgcagaagaagccaaagacttggctagc
caaatgttaaatcacaaattgatcaccaaacaaactggtgctgctggtaaagaagtaacc
gctgtttacattgttgagagaagagatgctgcttctgaagcctatgttgccatcttgatg
gacagagctcgtcaaaccccagttattgtcgcttctgcccaaggtggtatggacattgaa
ggtgttgctgccaaagacccatctgctattaaaactttcccagttcctttggaagaaggt
gtttctgattccttggccactgaaatagccggtgctttaggattcacccaagatgccatc
ccagaagctgccaaaaccatccaatcattgtacaaatgtttcattgaacgtgactgtacc
caagttgaaatcaatcctttatctgaaactcccgaccacaaggtcttggccatggatgcc
aaattaggtttcgatgacaatgcctctttccgtcaagaagaagtgttctcatggagagac
ccaacccaagaagatcctcaagaagctgaagccagtaaatatggattgaactttatcaaa
ttggatggtaacattgccaacattgtcaatggtgctggtttggccatggctactatggac
attatcaaattatacggtggtgaaccagctaacttcttggactgtggtggtactgctact
ccagaaaccattgaaaaagcttttgaattgatcttgtcagatccaaaagttaacggtatt
ttcgtcaacatctttggtggtattgtcagatgtgattatgttgccaaaggtttgattgct
gccaccaagaacttcaaattggacattccagttgttgtcagattacaaggtactaatttg
gctgaagctaaagaattaattgaaaactctggtttgaaattatatgctttcgaagatttg
gacccagctgctgaaaaaattgtccaattggctccaaagaacaattaa

DBGET integrated database retrieval system