KEGG   Candida dubliniensis: CD36_34440Help
Entry
CD36_34440        CDS       T01140                                 

Definition
(RefSeq) serine/threonine-protein kinase, putative
  KO
K08866  serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
cdu  Candida dubliniensis
Pathway
cdu04111  Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    CD36_34440
Enzymes [BR:cdu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     CD36_34440
Protein kinases [BR:cdu01001]
 Serine/threonine kinases: Other
  TTK family
   CD36_34440
Chromosome and associated proteins [BR:cdu03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     CD36_34440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Kdo RIO1
Motif
Other DBs
NCBI-GeneID: 8049924
NCBI-ProteinID: XP_002422377
UniProt: B9WMR8
Position
R:complement(1892740..1894809)
Genome map
AA seq 689 aa AA seqDB search
MMPHDSLSHVATSFSSHRSSPSSNSSTKRRLALEDDPTVLPPALSSYSIQCLNERTKTST
LPSQITGKYELDFPDSNNKRDNTLRNKLAAHFTNESTRSREISNSFTNLSEDRSSINTAP
TTTPGSKTFEDLRSKRKRRFGKSLGPPKRGIDIAQESTPVGDKSSSENESKSNLTPQLKP
LNEIKPKAPSLERFSPLLKRNHKSIETDDTITKRIEARRREQMEQEFVKKEKENELAEME
IKKLEQVAVLQSPFEELKFNEFQEPKQSRVPLREIPVNSADVFRKPKAPKSVVSPSPNVQ
SNPIIPPTKPVFRNTSQDFPQPPQQLQHNQKHQQALPSAPIPPKVHYDRPQHSGNKRALI
INGKSYEKLELIGKGGSSKVYRVRSLNNNCVYALKKVELGQFEDVSGFKGEIDLLTKLKS
CERVVTLVDYATTESSLYLIMEKGDLDLAEVLQYRLKLDAPLDLNFVKYHTIEIFKCIKD
VHDAGIVHSDLKPANFLFVRGMLKIIDFGIANAVPDHTINVYRENQIGTPNYMAPEAICE
SNYTSARIWKVGKPSDIWSIGCILYQFIYGKAPFAGYSGNQKLMAITNPHIKISFPSSGI
GNTPVPLSAIELMKNCLHRDPNDRWTIEQCLACDFLSPKIVSENFIREVVHQSINYGYNS
RISGDGMTSDRYDALVDSVMKQIQNLNYS
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgatgccacatgattcactatcacatgtggcgacaagtttttccctgcatcggtcgtca
ccatcaagcaacagttcaaccaaacgacgtttagcattagaggatgacccaacagttcta
cccccggcattaagctcatatagtatacagtgtttaaatgaaagaaccaaaacatccaca
cttccatctcaaataacaggaaagtatgaactagatttcccggactcgaataataaaaga
gacaatactttacgaaacaaattagctgcacattttacaaacgaatcaactagatctcgt
gaaatatctaattcattcacaaacttatctgaagacagatcaagcataaatactgcgcca
acaacaaccccaggcagcaaaacatttgaagacttgcgcagtaaacggaaaagaaggttt
ggtaagctgttgggaccacctaaaagaggtattgatatcgctcaagaaagcacaccagtt
ggagataaactgtcctctgagaatgaaagcaagtctaacctcacaccgcaactcaaaccg
ttgaatgaaataaagccgaaggcaccatcattagaaagattctcccctcttttgaaaagg
aaccataaatccatcgagactgacgataccattacaaaacgaatcgaagcaagaagacga
gaacagatggaacaagagtttgtgaaaaaagaaaaggaaaacgaattggcagaaatggaa
ataaaaaaacttgaacaagtagcagtactacagtctcctttcgaagaacttaagtttaat
gaattccaagaacccaaacaaagtcgtgtaccactacgtgaaatacctgtcaatagtgct
gatgtttttcgaaagccaaaagctccaaaatctgttgtatctccttctcctaatgtacaa
agcaaccccattataccacctacgaaaccagtttttagaaataccctgcaagactttcca
caacctcctcaacaacttcaacataatcaaaaacatcaacaggcattaccctctgcacct
ataccacccaaagttcattacgatagaccccaacattccggaaataaacgagcattgata
ataaatggcaagctgtacgaaaaattggaacttataggaaaaggaggatcatccaaagta
taccgagtaagatcactcaataacaattgtgtttatgccctcaaaaaagttgaacttgga
caatttgaagatgtgagtggatttaaaggagaaattgatttacttaccaagttaaagtca
tgcgaaagagtagtgactttagttgattacgccaccactgaaagctcgctttatcttata
atggagaaaggtgatcttgacttggctgaagttcttcaatataggttgaaattggatgct
cctttggatttgaactttgtcaaatatcacaccattgaaatttttaaatgcataaaagat
gttcacgatgctggcattgtacacagtgatttgaaaccggcgaattttttgtttgtcagg
ggcatgttaaaaattatagactttggtattgcaaatgctgtacctgaccacaccataaat
gtttaccgagagaaccagattggtacacccaattacatggcgccagaagccatatgcgaa
tcaaattatacctcagcaagaatttggaaggtaggcaaaccttctgatatttggtcgatc
gggtgtattttgtatcaattcatatatgggaaagcaccttttgctggctattctggcaac
cagaaattgatggctataacaaatccgcatataaagatttcgtttccgagcagtggcatt
ggcaatactccggtgcctcttagtgctatcgaattgatgaaaaattgtttacaccgtgac
ccaaacgatagatggacaatagagcaatgtctagcctgtgattttctactgccgaaaata
gttagtgagaattttattcgtgaagttgttcaccaatctatcaactatggctataacagt
agaatctcgggtgacggtatgacaagtgatagatatgatgctttggtggactctgtaatg
aaacaaatacaaaacttaaactacagctag

DBGET integrated database retrieval system