KEGG   Candida dubliniensis: CD36_43070Help
Entry
CD36_43070        CDS       T01140                                 

Definition
(RefSeq) karyopherin, putative
  KO
K14289  exportin-5
Organism
cdu  Candida dubliniensis
Pathway
cdu03013  RNA transport
Brite
KEGG Orthology (KO) [BR:cdu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    CD36_43070
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cdu03016]
    CD36_43070
   03036 Chromosome and associated proteins [BR:cdu03036]
    CD36_43070
Transfer RNA biogenesis [BR:cdu03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    CD36_43070
Chromosome and associated proteins [BR:cdu03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Other miRNA pathway proteins
     CD36_43070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Xpo1 IBN_N
Motif
Other DBs
NCBI-GeneID: 8047711
NCBI-ProteinID: XP_002419969
UniProt: B9WG15
Position
4:687601..691338
Genome map
AA seq 1245 aa AA seqDB search
MTMDSGGVQQIVSALQIVYDPKSTNDRRREAQTFLDTIKTNEESPFWGYQLALPENNGDN
YIVRYFGLSLLQQSITTNFHTFDQAKTAAVKQWIIDLSTKVEPSDPHYIKEKIALLWVSI
AKRVWGNHLIKSRDSHHNSVDENTTISTNLENNNKSSVSLTEQESVDGWVSMDADLLKLW
NNNITCRELSLIVIRTLFEDIYLLDDPISSKRSTLLNQLSILIVTPQSVLESMYENNPNV
TICKASADGWFITWSRYLVELLTNNDYKDKICQTFVPKILSAFKTCLHWINPSVLRQENI
MQTLIGILTIPDVPMKILAVDCLHILFTRTYTQPEDFDFFIGSVFTSEGITKLSEFYHSL
HLDPDDVDETVYSLLKKTVEMIVSLSEYLNIASRNKVSWESSDVDSYLKLVLETTSHPSL
IISGLSLQMWITILRFDELSAKPQFVKLMPDLLEIAANRTINYTYDENNISKKFLDVDFD
STPDANSFLQNYRKFNEDITRITVCKDPENGLAWLENRLQVFFSSELGNRCVSEFKLGEK
SEEFNYGSSQLSTIDYTLRGVTRWNEWYNREDKNTIKERLNKLVESLCERLLAMNFASPL
LVRKQMQTLVHFAPLLKDVNPPLMFRALEKILTTATYPYPPNVSDEDMELIRDLRGSCGT
ELNRYAYMMPEGLSKIFTDLENAIANILSAKKVSDHENVALKSFLLVIAFRSSIGNKDEI
FAKIVDPDLAAWSAPETEKGLMDLHWFMERIGIVEIASYFQSRGITATTNLLEAKMDEEG
KLLKTKLKDHWSSIFPIRATRIFIQYSIEKLNHNSPEYLHLLKLWKPRIQPIVPHILQLL
TQIQAYHDPQNWKDLPIEVQSFVKESCTERFWQQGVSIQSKETFMEENVKAALTLRDFAD
SVGHLIRYTREYAFLTVGSIAQLEDTLYEIPGIASMIWKAVAGDTIGVTLHSWKHMINSC
LRVVIKFCPVKYVEVFMSELLPAVFLDLDKLLVDRWTKINGNGIQLQGNEDDETLSEEMM
EEHMLRQLTATVVRLLMDVVGQYNARPATDTQFACKKLVAENKEVLAPFLQICCHLFLFK
DTKCSFNTILVIRNILPEVLLKDDEVDKYLSDHLIKSLLEVLLDDYFAETHSEAAIALTT
LYCALRSKNDYPARILIQNLQNINTRDISNFESQLVNSKSLRHQRGALIDLVRRSKNQEV
DEMTKRKKELEAVSIANRKKRNGGVDVMNDPYTENGALGQLFGED
NT seq 3738 nt NT seq  +upstreamnt  +downstreamnt
atgacaatggatagtggaggcgttcaacagatagtatctgcattgcaaatagtgtatgac
cccaaatcgacaaatgatcgaagaagagaggcacagacctttttagataccatcaaaaca
aacgaggaaagtccgttctggggttatcaattggcattgccagaaaataatggcgacaat
tacattgtaaggtactttgggttgtcactattacagcaatcgataactacaaattttcac
acttttgatcaagcaaagacagctgctgtaaagcagtggataattgatttatccaccaaa
gttgaaccaagtgatcctcattacatcaaagagaagattgctttgttatgggtttcaata
gcaaagagagtttggggaaatcatctaatcaaatcgagggactctcatcacaacagtgta
gatgaaaacacaacaatatcgacaaacctagagaataataataaactgtcggtctctctc
acggaacaagagtccgtcgatggctgggtatctatggatgccgatttattaaagttgtgg
aataacaacataacatgccgagaactatctttgattgttattagaacattgtttgaagac
atttatttgttggatgatccaatttcctccaaaagaagcacactattgaatcaattatca
attttgattgtgactcctcaaagtgtattagagtctatgtatgagaacaatcctaacgtc
acaatttgcaaggctctggctgatgggtggtttataacatggtcgagatatttggttgag
ttgttaactaacaacgactataaagataagatctgccaaacatttgtgcccaagatatta
tcggcatttaaaacttgcttacattggatcaacccctccgtattaagacaagagaatatc
atgcaaacgttaattggtatattaactatccctgatgtgccaatgaaaattttagccgtt
gattgcttgcatattttgtttacgagaacttacacccaacctgaagattttgacttcttc
attggttcagtatttaccagtgagggcataacaaaattaagcgagttttatcattcatta
catttagatcctgatgatgtagacgaaactgtttattcactcttgaagaaaacagtggaa
atgatcgtgtccttgagtgaatacttgaatattgcttcgagaaataaagtttcgtgggaa
agttctgatgttgatagctatttgaaattggtattggaaaccacaagccaccctagtttg
ataattagtggtttatcgttgcaaatgtggatcaccatattgagattcgatgagttaagt
gcgaaacctcaatttgtaaaactcatgccagacttgctagagattgctgccaatagaacc
ataaattatacctacgatgaaaacaacatctcaaaaaagtttttggacgttgatttcgat
tcaactccagatgccaattcgtttctacaaaactacagaaaattcaatgaagatataaca
cgtatcactgtgtgcaaggatcctgaaaatggattagcatggctcgaaaatagacttcaa
gtattttttagctcggaattaggtaacagatgcgtcagcgaatttaaattaggtgaaaag
tcagaagagttcaattatggatcgtctcaacttagcacaattgattacactttacgtggt
gtcactcgttggaatgaatggtataatcgggaggacaaaaatacaattaaggagagatta
aataaattggttgaatctttatgtgaacgtttattggcaatgaattttgccagcccatta
ttggttagaaagcagatgcaaacattagttcattttgctccacttttgaaggatgtcaac
ccaccgctcatgtttagagctttagaaaagattcttactactgcgacttacccttatcca
cctaatgtatcggatgaggatatggaattgattcgagatttaagaggtagctgtggaacc
gaattaaatagatatgcctacatgatgcctgaaggattgagcaagatatttactgattta
gagaatgccattgccaatatattatctgcaaaaaaagtcagtgatcatgaaaatgttgca
ctcaaatcgtttcttttggtaattgcgtttaggtcgtctattggtaataaggatgaaata
tttgcaaagattgtcgatccagatttagccgcatggtctgcacccgagacggagaaaggg
ttaatggatttacattggtttatggaaagaattggtattgttgaaattgcttcctatttc
cagagtcgtggaataactgccactacgaaccttttggaggcaaaaatggatgaagaaggt
aaattgttgaaaacaaagttaaaggatcactggtcttctattttcccaataagagcgaca
agaatttttattcagtatagtatagagaaattgaaccataattctcctgagtatttacat
ctattgaaactttggaaaccaagaattcaaccgattgtgccgcatattttgcaactattg
acacaaattcaagcttatcatgatcctcagaattggaaagatttaccaatcgaagttcaa
tcgtttgttaaagagagttgtaccgaaagattttggcagcaaggagtatctattcaatcg
aaagaaacatttatggaggagaatgtgaaagctgctttgactttaagggattttgccgat
tcggtggggcatttgattagatatactcgagaatatgcatttttaactgtgggctcaata
gctcaattggaagacacattgtatgaaattcctggcattgcactgatgatctggaaggcc
gtggcgggtgatacaattggtgtcacattacatagttggaagcatatgataaacagttgc
ttacgagtagttattaagttttgtcctgtgaagtatgttgaagtatttatgagtgaatta
ttaccagcagtgttcttagacttggacaaattacttgttgatagatggactaaaataaat
ggcaatgggatacaattgcaaggaaacgaagatgacgaaactttgtcggaagagatgatg
gaagaacacatgttaaggcaattgactgcaactgttgtgagattattgatggatgttgtt
ggtcaatataatgctagaccagccactgacactcagtttgcatgcaagaaattagtagct
gagaataaggaggttttagccccattcctacaaatatgttgtcatttgtttttgttcaaa
gatacaaagtgttcgttcaatactattttggtaatacgtaacatcttgcccgaagtcttg
ttaaaggacgacgaagttgataaatatctttctgatcaccttatcaagtctttgcttgag
gtattgcttgatgattattttgctgagacgcatagtgaagctgcaattgcattaacaact
ttgtattgtgctttgagatctaaaaacgattacccagccaggattttgattcagaattta
caaaatataaatacccgagacattagtaattttgaatcacagttggtcaattcaaaatcc
ttgcgacaccaaagaggtgctttgatagatttagtgagaagatctaaaaaccaagaagtt
gatgaaatgaccaaaagaaagaaagagttggaagcagtttctattgctaatagaaagaag
agaaatggtggtgttgatgtcatgaatgatccgtatactgaaaatggtgcattgggacaa
ttgtttggcgaagattaa

DBGET integrated database retrieval system