KEGG   Candida dubliniensis: CD36_51100Help
Entry
CD36_51100        CDS       T01140                                 

Definition
(RefSeq) glucose-6-phosphate 1-epimerase, putative
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
cdu  Candida dubliniensis
Pathway
cdu00010  Glycolysis / Gluconeogenesis
cdu01100  Metabolic pathways
cdu01110  Biosynthesis of secondary metabolites
cdu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CD36_51100
Enzymes [BR:cdu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     CD36_51100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 8048045
NCBI-ProteinID: XP_002420414
UniProt: B9WH51
Position
5:277086..277985
Genome map
AA seq 299 aa AA seqDB search
MPVEELEDRVIITDPTDPTNRATILKFGATVVSWKNNNEEKLWLSEGAHLDGSKAVRGGI
PLVFPVFGKQKDSTHPTFKLPQHGFARNSTWEFLGQTQESPITVQFGLGPENVDPETLKL
WNYDFTLILTVSLTKDNLVTSIDIENTGKEAFEFNWLFHTYYRIHDITDTLVTNLIDQQC
YDQLIGESYIEKAPVISFHEEFDRIYSKVNLEKSIQIVDKGKVLFNLHRKNLPDSVVWNP
WTKKAEGMADFQPKSGFHQMVCVEPGHVDSMISLPAGGKWSGGQEITIGGDIKVQANIY
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgcctgttgaagaacttgaggaccgtgtgatcattactgatccaactgacccaactaac
agagcaaccattttgaaatttggtgctactgttgtttcttggaaaaataataatgaagag
aaattatggttatcagaaggtgcacatttagatggaagtaaagctgttagaggagggatt
ccattagttttcccagttttcggtaaacaaaaagattcaactcatccaactttcaaatta
cctcaacatggatttgcccgtaactctacttgggaatttttgggacaaactcaagaaagt
cctattacggttcaatttggattaggtccagaaaatgtcgatccagaaactttaaaatta
tggaattatgatttcactttgattttaactgttagtttgactaaagacaatttggttact
tcaattgatatagaaaacactggtaaggaagcatttgaattcaattggttgttccataca
tattatagaattcatgacattactgatacattggttaccaatttgattgatcaacaatgt
tacgatcaattgattggtgaatcatatattgaaaaggcacccgttatcagtttccatgaa
gaatttgatagaatttattcaaaagtcaatttagaaaaatccattcaaattgtcgataaa
ggaaaagttcttttcaatcttcatagaaaaaacttgcctgattctgtggtatggaatcca
tggactaagaaagctgaaggtatggctgatttccaaccaaaatctgggttccatcaaatg
gtttgtgttgaaccaggtcatgttgactcaatgatttctttaccagctggtgggaaatgg
tcaggtggccaagaaatcactattggcggagacattaaagttcaagctaatatatattag

DBGET integrated database retrieval system