KEGG   Candida dubliniensis: CD36_52080Help
Entry
CD36_52080        CDS       T01140                                 

Definition
(RefSeq) threonine synthase, putative
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cdu  Candida dubliniensis
Pathway
cdu00260  Glycine, serine and threonine metabolism
cdu00750  Vitamin B6 metabolism
cdu01100  Metabolic pathways
cdu01110  Biosynthesis of secondary metabolites
cdu01230  Biosynthesis of amino acids
Module
cdu_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CD36_52080
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CD36_52080
Enzymes [BR:cdu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CD36_52080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-GeneID: 8048199
NCBI-ProteinID: XP_002420513
UniProt: B9WHF0
Position
5:529614..531146
Genome map
AA seq 510 aa AA seqDB search
MPSSSQVYRSTRSNQPEELSFEDVVMTGLAPDGGLYLPSSIPQLPNDFLTKWSDLSFNEL
AFEILRLYINENEIPNADLKDLIARSYSTFRSSEVTPLKKLNDNLYILELFHGPTYAFKD
VALQFVGNLFEYFLTRRNAQKDLTKQPKDIITVVGATSGDTGSAAIYGLRGKKDVSVFIL
YPTGRISPIQEEQMTTVEDGNVHTLSVNGTFDDCQDIVKQIFGDKEFNDKYHVGAVNSIN
WARILAQQTYYFYSYFQLQKQAKTTNKVRFVVPSGNFGDILAGYYAYRMGLPVDKLIIAT
NENDILDRFIKSGEYAKEQEVGVKATYSPAMDILISSNFERLLWYLIRDNVPEVNKSDEK
AGQLLNDWMKQLKEQGKFKVPAEVIDAARQVFDSQRVDNDTTVQTIKQVYDQSGDKYVID
PHTSVGVTTSYSFIAKDTEPTQYISLSTAHPAKFSEVVNKALDSFDGYSFDKDVLPAELK
ALSSKEKRIKLIDEASVEKVKQAIKDELKF
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgccttcttcatcacaagtttatagatctactagatctaaccaaccagaagagttatca
tttgaagatgttgttatgacggggttagcccccgatggtggattgtatttaccatcctct
atccctcaattacctaatgactttttaactaaatggtcagacttgtcatttaatgaatta
gcttttgaaatattaagattatatatcaatgagaatgaaatccctaatgcagatttaaaa
gatttgattgctagatcatattcaacattcagatcatcagaagtgactcctttgaaaaaa
ctcaatgacaatttatacattttagaattatttcatggtcctacctatgcattcaaagat
gttgctttacaatttgttggtaaccttttcgaatatttcttaaccagaagaaatgcgcaa
aaagatttgactaaacaaccaaaagatatcatcaccgttgttggtgccacttctggtgac
acaggatcagctgccatttatggattacgtggtaagaaagatgtctctgtatttatattg
tatcctactggaagaattagccctatacaagaagagcaaatgacaactgttgaagatggt
aatgtccataccttatcagtcaatggtacatttgatgattgtcaagatattgtcaaacaa
atatttggtgataaagaatttaatgataagtatcatgttggggccgtcaactctatcaat
tgggcaagaatcttagcgcaacaaacatactatttctattcttatttccaattacaaaaa
caagctaaaaccactaataaggttagatttgttgttccttcaggtaattttggagacatt
ttggctggttattatgcttacagaatgggattaccagttgacaaattgattattgccact
aacgaaaatgacatcttggacagatttataaaatcaggagaatatgccaaagagcaagaa
gttggtgttaaggcaacttattccccagcaatggatattttgatctcatcgaattttgaa
agattgttatggtacttgatcagagacaatgttcctgaagtcaacaagagtgatgaaaaa
gcaggtcaattgttgaacgattggatgaaacaattgaaagaacaaggcaaatttaaagtc
ccagctgaggtcattgatgctgcaagacaagttttcgattcacaaagagttgataatgat
accacggtgcaaaccatcaaacaggtatatgaccaatctggtgataaatatgtcattgat
cctcatacttctgttggagtcactacttcttattcatttattgctaaagatacagagcca
acccaatacatttctctttccacggctcatccagcaaaattctccgaagttgtcaataaa
gcccttgattcctttgatggttattcgtttgacaaagatgttttgccagcagaattgaaa
gccttgagcagtaaagagaagagaattaaattgattgacgaagctagtgttgaaaaagtc
aaacaagctattaaagacgaattgaagttttag

DBGET integrated database retrieval system