KEGG   Candida dubliniensis: CD36_53520Help
Entry
CD36_53520        CDS       T01140                                 

Definition
(RefSeq) guanylate kinase, putative
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cdu  Candida dubliniensis
Pathway
cdu00230  Purine metabolism
cdu01100  Metabolic pathways
Module
cdu_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CD36_53520
Enzymes [BR:cdu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CD36_53520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_18 AAA_33 AAA_22 MMR_HSR1 ABC_tran AAA_24 AAA_14 AAA_28 RNA_helicase RsgA_GTPase AAA_30 AAA ATPase_2 NACHT T2SSE AAA_29 DUF2075 NTPase_1 Viral_helicase1 Rad17 AAA_19 KAP_NTPase Tfb5 cobW AAA_5 MobB Adeno_IVa2 AAA_23
Motif
Other DBs
NCBI-GeneID: 8048237
NCBI-ProteinID: XP_002420647
UniProt: B9WHT5
Position
5:892728..893300
Genome map
AA seq 190 aa AA seqDB search
MSSSANRPIVISGPSGTGKSTLLKKLFAEYPDRFGFSVSNTTRKPRPGEVDGKDYNFSTV
EEFKKLIDENKFIEWAQFSGNYYGTTIKAVKDVAEQGRTCLLDIDMQGVKSVKKTDLNAR
YLFISPPSIEELKSRLTGRGTETEDSLQKRIAAASDEMEYAQTGAHDKIIVNDDLDKAYA
EFKKFIVDEQ
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcatctgcaaatagaccaatagttatttccggtccttcaggtactggtaaatca
actttattgaaaaaattatttgctgaatatcctgatagatttggattttcagtttccaac
accaccagaaaaccaagacctggtgaagttgatgggaaagattataattttagtacagtt
gaagaatttaaaaaattaattgatgaaaacaaatttattgaatgggcccaattttctggt
aattattatggtacgacaattaaagctgtgaaagatgttgctgaacaaggtagaacttgt
ttattggatattgatatgcaaggggtcaaatcagttaagaagactgatttgaatgccaga
tatctttttataagtcctccatctattgaagaattgaaaagtcgattgacaggtagagga
actgaaactgaagacagtttacaaaaaagaattgctgctgcttctgatgaaatggaatat
gcccaaactggtgctcatgataaaataattgttaatgatgatttggataaagcttatgct
gaatttaagaaatttatcgttgatgaacaataa

DBGET integrated database retrieval system