KEGG   Candida dubliniensis: CD36_54320Help
Entry
CD36_54320        CDS       T01140                                 

Definition
(RefSeq) methionyl-tRNA synthetase, cytoplasmic, putative
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cdu  Candida dubliniensis
Pathway
cdu00450  Selenocompound metabolism
cdu00970  Aminoacyl-tRNA biosynthesis
cdu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CD36_54320
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CD36_54320
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cdu01007]
    CD36_54320
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cdu03016]
    CD36_54320
Enzymes [BR:cdu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CD36_54320
Amino acid related enzymes [BR:cdu01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CD36_54320
Transfer RNA biogenesis [BR:cdu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CD36_54320
 Prokaryotic type
   Other AARSs
    CD36_54320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g MetRS-N tRNA-synt_1 tRNA-synt_1e Anticodon_1 EKLF_TAD1
Motif
Other DBs
NCBI-GeneID: 8048383
NCBI-ProteinID: XP_002420726
UniProt: B9WI14
Position
5:complement(1066970..1069216)
Genome map
AA seq 748 aa AA seqDB search
MSLEVYGVKGNTLLALANNLKLSIALAAFQPKVELALNEVESNLSLKDKKSGFELVEPNA
IVKYLANDFNTTEAIQFEEEVLYAAIKSNKKDEIAKITGLPKFAKEELTPSQIIVFASLY
PAFKDNKENEWFIKFSQLPEVATGIKNALEITPVEREKETNTGKQNVETGHLVKKQANKI
LPKSDERNILITSALPYVNNVPHLGNIVGSVLSADIYSRYAKNRNYNTLFICGTDEYGTA
TETKALEENVTPQQLCDKYHAIHKEVYDWFDIGFDYFGRTTTPLQTEIAQDIFMKLHNKG
YLEEKTTEQLYCEHHKSFLADRFVEGTCPKCDYEDARGDQCDKCGNLLDPLELINPRCKV
DGNTPVVKESTHIYLKLNDLEEPLKEWVLDSSAKGAWSKNSKNITDSWIKRGLEPRCITR
DLIWGTPVPLKGYDKKVLYVWFDATIGYVSITANYFKDSNTDDYLKWWRNPENVDLYQFM
GKDNVPFHTVVFPASQIGTGDKWTKLHHLSTTEYLQYENGKFSKSRGVGVFGNNAKETGV
SPSVWRYYLASNRPETQDAHFSWDEFVAKNNSELLANLGNFVNRIVKFVIAKYNGVIPKF
DTKNIPDYGKFETDINSLLASYIDNMENVNLRKGLELAMAISSRGNQFLQDNKLDNSLYA
NQPAKSDAVVAVAINLVYLVSAIIYPFMPETTAKIDQILNAPALSITNKFELVLLPGHCI
GKAQYLFTRIDDKKIDEWRKLYGGQQKK
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgtccttggaagtatatggagttaaaggtaacacattattagcattggctaataactta
aagttatctattgcattagcagcttttcaacctaaagtggaattagctttgaatgaagtt
gaatcaaatttgtctttaaaagataagaaatccggttttgaattggttgagccaaatgca
atcgttaaatacttagccaacgacttcaacaccactgaagctattcaatttgaggaagaa
gtgttgtatgcagcaattaaatcaaacaagaaagatgaaatcgccaaaatcaccggttta
ccaaagtttgctaaggaagaactaacaccttctcagattattgtatttgcaagtttatat
cctgctttcaaagacaataaagaaaatgaatggtttatcaagttttcacaattaccagaa
gttgcaacaggtatcaaaaacgctttagaaattaccccagtggaaagagaaaaggaaacc
aacaccgggaagcaaaatgtcgaaactggtcatttagtgaaaaaacaagcaaacaaaatt
cttcctaaatctgacgaaagaaacattttaattacttcagccttaccatatgttaacaat
gttcctcatttgggtaacattgttgggtcggttttgtctgctgacatttacagccgttat
gccaagaatagaaactacaatactttattcatttgtggtactgatgaatacggtactgcc
acagagaccaaggctttggaagaaaatgtcaccccacaacaattatgtgacaaataccat
gctattcataaagaagtctatgattggtttgatattggatttgactatttcgggagaacc
acaacccctttgcaaactgaaattgctcaagatatatttatgaaattgcacaataaagga
tacttggaagaaaaaactacagaacaattatattgtgaacaccataaatctttccttgct
gacagatttgttgaaggtacttgtccaaaatgtgattatgaagatgccagaggagaccaa
tgtgacaaatgtggtaacttattggatccattggaattgattaatccccgttgtaaagtt
gatggcaatacccctgttgttaaagaatcaacccatatttaccttaagttgaatgacttg
gaagaaccattgaaggaatgggttcttgattcttcagcaaagggtgcttggtccaaaaat
tctaagaatattacagactcttggattaaaagaggtttagaaccaagatgtattaccaga
gatttaatctggggtacaccagttccattgaagggatacgacaagaaagttttatacgtg
tggtttgatgccacaattggttatgtttccataactgctaattatttcaaagattcaaac
accgatgattatctcaaatggtggagaaacccagagaacgttgatttgtatcagtttatg
ggtaaagataatgttccattccatactgttgttttcccagcctctcaaattggtactggt
gacaagtggaccaagttacaccatttgagtactaccgaatatttgcaatatgaaaacggc
aaattctccaagagtagaggtgttggagtgtttggtaacaatgccaaggaaactggagtc
tcaccttctgtttggagatattacttggcctcaaatagaccagaaactcaagatgctcat
ttctcctgggatgaatttgttgctaaaaacaattctgaattattggccaatttgggtaac
tttgttaatagaattgttaagtttgttattgccaaatataatggagttattccaaaattc
gatactaagaacataccagattacggcaagtttgaaactgatattaattctttgttggcc
agttacattgacaacatggaaaatgtgaatttgagaaaaggtttagaacttgccatggct
atatcatccagagggaaccaatttttgcaagacaacaagttggataattcgttgtatgcc
aaccaacctgccaaatcagatgcagttgttgctgttgcaattaatttggtttatttagtt
agtgctattatttacccttttatgccagaaacaacagctaaaattgatcaaattttgaat
gctcctgccttatcaattacaaataaatttgaattggtgttgttaccaggtcactgtatt
ggtaaagcacaatatttgttcacaagaattgatgacaagaagattgatgaatggagaaaa
ttgtatggtggacaacaaaagaagtaa

DBGET integrated database retrieval system