KEGG   Candida dubliniensis: CD36_60320Help
Entry
CD36_60320        CDS       T01140                                 

Definition
(RefSeq) nucleolar protein, putative
  KO
K14565  nucleolar protein 58
Organism
cdu  Candida dubliniensis
Pathway
cdu03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:cdu00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    CD36_60320
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cdu03009]
    CD36_60320
Ribosome biogenesis [BR:cdu03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    CD36_60320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nop NOP5NT
Motif
Other DBs
NCBI-GeneID: 8048717
NCBI-ProteinID: XP_002420834
UniProt: B9WIC2
Position
6:complement(78106..79656)
Genome map
AA seq 516 aa AA seqDB search
MAYVLTETAAGYALLKAADKKIHKSSSLVEDLNTAEKVAEQFKIHRFEKFQSAANALEEA
NAIIEGKVSESLQKLLEDAKSDKKATLIVSEAKLGNAINKLGLNFQVVSDAASLDLQRAI
KQFLPDLLPGLDDSALKQMSLGLAHSMGRHKLKFSADKVDTMIIQAIALLDDLDKELNTY
AMRCKEWYGWHFPELAKMITDSVAYARIILTMGVRSNASETDLSEILPEEVEEQVKAAAE
VSMGTEITEDDLNNIKALAEQIVDFAAYREQLSNYLSSRMKAIAPNLTAMVGELVGARLI
AHAGSLTSLAKAPASTVQILGAEKALFRALKTKHDTPKYGIIYHASLVGQASGKNKGRIA
RTLAAKAAVSLRYDCFDEERDESDDFGLENRAKVESRLSQLEGRDMRTTSKVVREQPKVE
ITEARAYNADADSTAAAAAAVAPTADSDDEESETEEVEEKKSKKEKKKEKKEKKEKKKDK
KRKRDDDKEEGSSKKSKKDKKEKKEKKEKKKKKEKK
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggcttacgttttaacagaaacagcagcaggatacgccttattgaaggcagctgataaa
aaaattcacaaatcttcctctttagttgaagatttaaacactgccgagaaagttgctgaa
cagttcaagattcatcgttttgaaaaatttcaatcagcagcaaacgctttggaagaagct
aatgccattattgaaggaaaagtctcagaaagtttacagaaattattagaagatgccaaa
tcagataagaaggctaccttaattgtgtcagaagccaaattaggtaatgccattaataaa
ttgggtttgaactttcaagttgtgagtgatgctgcttctttggatttgcaaagggccatc
aaacaatttttgccagacttattacctggtttagacgattcagcattaaaacagatgtca
ttgggtttagctcactcaatgggccgtcataaattaaaattctctgccgacaaggtagat
accatgattattcaagctatagccttattggacgatttagataaagaattaaatacctat
gccatgagatgtaaggaatggtacggttggcatttcccagaattggccaaaatgattact
gattctgttgcatatgctagaattattttgaccatgggtgttagatccaatgcatctgag
accgatttatctgagattttaccagaagaagttgaagaacaagttaaagctgctgctgaa
gtctctatggggactgaaattactgaagatgatttgaataacataaaagcattggccgag
caaattgttgatttcgctgcttatagagaacagttgtccaattacttatcctctcgtatg
aaagcaattgctccaaacttgactgctatggttggagaattagttggtgctagattgatt
gctcacgcaggttcattgacatcattagctaaagccccagcttcaactgtacaaattttg
ggtgccgaaaaggctttattcagagctttgaaaaccaagcacgacacaccaaagtatggt
ataatttatcatgcttctttggttggtcaagccagtggtaaaaataaaggtagaattgca
agaacattggctgctaaggctgctgtgtcattgagatatgattgctttgacgaagaaaga
gatgaatcagatgattttggtttagaaaatagagccaaggttgaaagtagattgagtcaa
ttggaaggacgtgatatgagaaccacctctaaagttgtcagagagcaaccaaaagtcgag
ataaccgaagctcgtgcttataatgccgatgctgattcaactgctgctgctgctgctgct
gttgctccaactgctgattcagacgacgaagaatctgagactgaagaagttgaagaaaag
aaatctaagaaagagaaaaagaaggaaaagaaagaaaagaaagagaaaaagaaggataag
aagagaaaaagagatgatgataaagaagaaggatcttctaagaaactgaaaaaggataaa
aaggaaaagaaagagaaaaaggaaaagaagaaaaagaaggaaaagaaataa

DBGET integrated database retrieval system