KEGG   Candida dubliniensis: CD36_60860Help
Entry
CD36_60860        CDS       T01140                                 

Definition
(RefSeq) hydrogen peroxide resistance protein, putative
  KO
K23856  peroxiredoxin [EC:1.11.1.15]
Organism
cdu  Candida dubliniensis
Brite
KEGG Orthology (KO) [BR:cdu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CD36_60860
Enzymes [BR:cdu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.15  peroxiredoxin
     CD36_60860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 8048755
NCBI-ProteinID: XP_002420878
UniProt: B9WIG6
Position
6:179924..180409
Genome map
AA seq 161 aa AA seqDB search
MSKFYELAPKDAKGEPYPFEQLKGKVVLIVNVASKCGFTPQYKGLEELNKKFADQPVQIL
GFPCNQFGHQEPGTNEEIGSFCSLNYGVTFPVLDKIEVNGDNTDPVYKYLKSQKSGVLGL
TRIKWNFEKFLIDQNGKVIERFSSLTSPESIGARIEELLKK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaattttacgaattagctccaaaagacgccaaaggtgaaccatatccatttgaa
caattgaaagggaaagttgttcttattgtcaatgttgcttccaaatgtggattcactcct
caatacaaaggtttagaagaattgaataagaaatttgctgatcaaccagtacagatcttg
ggtttcccatgtaatcaatttggtcatcaagaaccaggtactaatgaagaaattggatca
ttctgttcattaaattatggtgttacattcccagtattggataaaatcgaagtcaatggt
gataataccgatccagtttataaatatttgaaatcacaaaagagtggtgttttgggattg
accagaattaagtggaattttgaaaaattcttgattgatcaaaatggtaaagttattgaa
agattcagttcattgacaagtccagaaagtattggtgctaggattgaagaattgttgaag
aagtaa

DBGET integrated database retrieval system