KEGG   Candida dubliniensis: CD36_71630Help
Entry
CD36_71630        CDS       T01140                                 

Definition
(RefSeq) 6-phosphofructokinase beta subunit, putative
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cdu  Candida dubliniensis
Pathway
cdu00010  Glycolysis / Gluconeogenesis
cdu00030  Pentose phosphate pathway
cdu00051  Fructose and mannose metabolism
cdu00052  Galactose metabolism
cdu00680  Methane metabolism
cdu01100  Metabolic pathways
cdu01110  Biosynthesis of secondary metabolites
cdu01130  Biosynthesis of antibiotics
cdu01200  Carbon metabolism
cdu01230  Biosynthesis of amino acids
cdu03018  RNA degradation
Module
cdu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CD36_71630
   00030 Pentose phosphate pathway
    CD36_71630
   00051 Fructose and mannose metabolism
    CD36_71630
   00052 Galactose metabolism
    CD36_71630
  Energy metabolism
   00680 Methane metabolism
    CD36_71630
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CD36_71630
Enzymes [BR:cdu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CD36_71630
Protein phosphatases and associated proteins [BR:cdu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CD36_71630
Messenger RNA biogenesis [BR:cdu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CD36_71630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK SHOCT UVR KNOX2
Motif
Other DBs
NCBI-GeneID: 8049071
NCBI-ProteinID: XP_002421381
UniProt: B9WK64
Position
7:complement(388628..391468)
Genome map
AA seq 946 aa AA seqDB search
MISIVNGTSTLSLVAGSKQTLDQAINFYTNILGLSVHSEQNDWTYLSNDDNKMIVKIKLD
SKSGLSLDQVSDRRTEIISKLNVIDWRSLDTTSVLKVENLVALIETLTTFNYTLQITPNE
LYPNEVYCVDPLGYIIGFTACDEPLTLVPPLQKSHPKPGLVSNLMSKSGSQSRNIEETKA
VRRNIAVMTSGGDSQGMNAAVRAVVRATIFHGSKAFAVQEGYAGLVKGGPEYIKEMNWQD
VRGFLAEGGTNIGTARCMEFKERWGRLKGCKNLIDAGIDGLIVCGGDGSLTGADLFRHEW
PSLIQELKDKGEITNEQFERHKHLYICGMVGSIDNDMAMTDATIGGYSALERICRAIDYI
DATANSHSRAFVVEVMGRHCGWLALMAGIATSADYIFIPEKPASSKDWEDQMCDIVGKHR
AQGKRKTIVIVAEGAITSDLKPITSDQVKDVLVDRLGLDTRITVLGHVQRGGTAVAFDRT
LATLQGVEAVKAILELTPDVPSPLIAIDENKICRRPLVEAVRITKSVASAIEAKDFEKAM
SLRDHEFKEHLANFMAMNTANHEKPTLPLEKRKKIAIINIGAPAGGMNSAVYAMATYCMS
RGHTPYAIHNGFAGLARHESVKSIEWIDIEGWNSIGGSEIGTNRQTPEETDIGMIAHYFE
KYQFDGLIIVGGFEAFVSLEQLEKSRAMYPSFRIPMVLIPATISNNVPGTEYSLGSDTCL
NSLMEYCDIVKQSASATRGTAFIIDVQGGNSGYIATFASLISGAQASYVPEEGISLQQLE
MDINSLREAFAVEQGMTKSGKLIIKSSNASKVLTPNTLADIFNDECHGDFDTKTAIPGHV
QQGGLPSPIDRSRGDRFAIRAVQFIEDHCDVLTPYRYELDFPVDDKKILNTAAVLGIKSS
RLKFTSIRHLFDFETELGRRMPKTIYWNSIRDIADQLVGRTRLDKP
NT seq 2841 nt NT seq  +upstreamnt  +downstreamnt
atgatttcaattgttaatggtacttccacactttcattggttgctggtagtaagcaaaca
ttagatcaagcaatcaatttttataccaacatacttgggttgtccgtccattcagagcaa
aatgactggacgtatttatcaaacgacgacaataaaatgattgtcaagataaaattagac
tccaaatctggattatctctcgatcaagtcagtgatagaagaacagagattatttccaaa
ttaaatgttattgattggagatcgttagataccaccagtgtcttgaaagttgaaaattta
gttgctttaattgaaactttaaccacatttaattacactttacaaatcacccctaatgaa
ttgtaccctaatgaagtctattgtgtggacccattgggctacattattgggtttactgct
tgtgatgaaccattaacccttgttccaccattacagaaatcccacccaaaaccagggttg
gtttccaacttgatgtcaaaatcaggttcccaatcaagaaacattgaagaaactaaagcc
gtgagaagaaatatcgctgtcatgacttctggtggggattctcaaggtatgaatgctgcc
gttagagccgttgttagagccacgattttccatggaagtaaggcctttgctgtccaagaa
ggttacgctggtttagtcaaaggtggccccgaatacattaaggaaatgaactggcaagac
gtcagaggtttccttgctgaagggggtaccaatattggtactgccagatgtatggaattt
aaggaacgttggggtagattgaaagggtgtaagaatttgattgatgctggaatcgatggg
ttgattgtgtgtggtggtgacgggtctttaaccggtgccgatttattcagacacgaatgg
ccttcattgattcaagaattaaaagataaaggtgaaatcaccaatgaacaatttgagaga
cacaaacacttgtacatttgtggtatggtgggttccattgataatgatatggccatgact
gacgcaacaattggtggttactcagcattagaaagaatttgtcgtgctattgattacatt
gatgccacagccaactcccattcgcgtgcctttgttgttgaagtcatgggtagacattgt
ggttggttagccttgatggccggtattgctaccagtgctgattatattttcattccagaa
aaacctgcttcctcaaaggattgggaagatcaaatgtgcgacattgttggtaaacataga
gctcaaggtaaaagaaagaccattgttattgttgctgaaggggctattacttctgatttg
aaaccaatcacatctgatcaagttaaagatgttttagtcgaccgattaggtttggacacc
agaatcaccgtgttgggacatgttcaaagaggtggtactgctgtggcttttgataggacc
ttagctactttgcaaggggttgaagcagttaaagccattttggaattaactcccgatgtt
ccatctccattgatcgccattgatgaaaataagatttgtcgtcgtccattggttgaagct
gtcagaatcaccaaatccgtggcttcagctatcgaagctaaggatttcgaaaaagcaatg
tctttaagagatcacgaattcaaagaacatttggctaatttcatggccatgaatactgcc
aatcacgaaaaaccaactttgcctcttgaaaaacgtaagaagattgccattattaacata
ggtgctcccgctggtggtatgaattctgctgtttatgctatggctacttattgtatgtct
cgtggtcacactccatatgctattcacaatgggtttgctggtttagcaagacacgaatca
gttaaactgattgaatggattgacattgaaggatggaatagtattgggggatcagaaatt
ggtaccaacagacaaacccctgaagaaactgacattggtatgattgcccattattttgaa
aaataccagtttgacgggttaattattgttggaggttttgaagcatttgtttctttagag
caattggaaaaatcaagagctatgtatccatctttcagaattcctatggttttaatccct
gccaccatttcgaataatgttcctggtaccgaatattctttagggtccgatacttgtttg
aattcattaatggaatattgtgacattgttaaacaatcagcatcagccaccagaggtacc
gcattcattattgatgttcaaggaggtaattctggatacattgccacgtttgcatcatta
atcagtggggcacaagcatcctacgttccagaagaaggtatttcattacagcagttggaa
atggacatcaattcgttgagagaagcatttgctgtggaacaaggaatgacaaagagtggt
aaattgatcatcaagtcgagtaatgcatctaaagtactaaccccaaacacattggcagac
atattcaatgatgaatgtcatggagactttgacaccaaaaccgctattccaggacatgtt
caacaaggtggattgccttcaccaatagatagaagcagaggtgatagatttgccattaga
gctgttcaattcattgaggatcactgtgacgttttgactccatacagatacgaattggat
ttccctgttgatgacaagaagatcttaaacacagctgctgtattaggtattaagtcttcc
cgtttgaaattcacttctatcagacatttgtttgatttcgaaactgaattaggcagaaga
atgccaaagaccatttactggaactctattagagatattgctgatcaattagtcggtcga
acaagacttgataagccataa

DBGET integrated database retrieval system