KEGG   Candida dubliniensis: CD36_85600Help
Entry
CD36_85600        CDS       T01140                                 

Definition
(RefSeq) glutathione S-transferase, putative
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cdu  Candida dubliniensis
Pathway
cdu00480  Glutathione metabolism
cdu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CD36_85600
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cdu02000]
    CD36_85600
Enzymes [BR:cdu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CD36_85600
Transporters [BR:cdu02000]
 Other transporters
  Pores ion channels [TC:1]
   CD36_85600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_C_3 GST_N_3 GST_N_2 GST_C_2 GST_C
Motif
Other DBs
NCBI-GeneID: 8047119
NCBI-ProteinID: XP_002419464
UniProt: B9WEE7
Position
3:1308593..1309363
Genome map
AA seq 256 aa AA seqDB search
MQTNHNRLDDSRSHRILWILDLLNLDYEVKIYLRHPETWRGPLQLFDVHQLGKAPILEVI
FGDGRPSIKISESGFIIQYLLRYYDTQNILYPINLDQQLEVDYYLHYAEGSFQHIQMALL
INSSAKHIAPFATKSVVKLITKAINNGYYKHEWFLNMKYLEDRLQQNGTGFFVGDKLTGA
DVILSFPIYENVFDNLEGIKEILGDKFNIKKMFPNLFNWSRMIKNNSSYKKITELMNEEV
EDLIALNPRFDYGREK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactaaccataataggctcgatgattcacgttcacatagaatactttggatatta
gatcttcttaatcttgattatgaagtgaagatatatttaagacatccagaaacttggcgt
ggacctttacaattatttgatgttcatcaattaggtaaagcaccaatattggaagttatt
ttcggtgatggaagaccatcaattaaaatatctgagctgggatttataattcaatattta
ttaagatattatgatacacaaaatattttatatccaattaatcttgatcaacaattggaa
gttgattattatttacattatgctgaagggtcatttcaacatatacaaatggcattatta
attaattcttctgctaaacatattgctccatttgccacaaaatcagtagtgaaattaatt
actaaagcaataaataatgggtattataaacatgaatggtttttaaatatgaaatattta
gaagatagattacaacaaaatggtacaggatttttcgttggtgacaaattaactggagct
gatgttatattaagtttcccaatttatgaaaatgtttttgataatcttgaaggtataaaa
gaaatattgggagataaatttaatatcaaaaaaatgtttcctaatttatttaattggagt
agaatgattaaaaataattcaagttataaaaaaataactgaattaatgaatgaagaagtt
gaagatttgattgcattgaatcctcgatttgattatggcagagaaaaataa

DBGET integrated database retrieval system