KEGG   Candida dubliniensis: CD36_86850Help
Entry
CD36_86850        CDS       T01140                                 

Definition
(RefSeq) dolichyl-phosphate-D-mannose:protein O-D-mannosyltransferase, putative
  KO
K00728  dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
cdu  Candida dubliniensis
Pathway
cdu00514  Other types of O-glycan biosynthesis
cdu00515  Mannose type O-glycan biosynthesis
cdu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdu00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosyntheis
    CD36_86850
   00514 Other types of O-glycan biosynthesis
    CD36_86850
Enzymes [BR:cdu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     CD36_86850
Glycosyltransferases [BR:cdu01003]
 O-Glycan biosynthesis
  O-linked Man type
   CD36_86850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PMT PMT_4TMC MIR PMT_2 Ost4
Motif
Other DBs
NCBI-GeneID: 8046971
NCBI-ProteinID: XP_002419585
UniProt: B9WER8
Position
3:1639331..1641634
Genome map
AA seq 767 aa AA seqDB search
MSTSVEPNETEALLRKQNELSTTASIEEKYPNHQEDEDEVDTLKRTQYDEAKETAESLKQ
VESILAPILFTALSFFVRFYRISVNDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLV
GLSGYLAGYNGSWDFPSGEKYPDYIDYTKMRLFNATFSALCVPLAYFTGKEIGFSMFTTW
LFTLMVALESSYVTLGKFILLDSMLLFFTVATVFCFSRFNNFNNKSQEFSRKWWKWILLT
GVSIGCTCSVKMVGLFVTTLVGIYTVVDLWNKLSDKSISWTKYIQHWFARIVALIIVPIF
IFMLSFKVHFDLLYKSGTGDANMSSLFQANLAGSDVGGGPREVSMFHSVITLKNQGLSGG
LLHSHVQTFPEGSKQQQVTTYGHKDSNNNWIFQRARGQPYYDTSGNTTDVEYIFDGMHVR
LMHPQTGRNLHTHDIPAPVSKSEYEVACYGNLTIGDPKDNWIVEIMEQASDEDKMRLHPL
TSSFRLKNEVMNCYLGVTGTTLPQWGFRQGEVVCYKNPFKKDKRTWWNIENNRNAILPPA
PEDFKLPKTKFIRDFIQLNLAMMATNNALVPDTEKQDDLASSFWQWPTLNVGIRMCGWGP
ENPKYYMIGSPATTWTSTFGVILFAFIVLYYLIRWQRQYVDFPSTNPHKLKLFVMGGIYP
MFGWGLHFLPFAIMGRVTYVHHYVPALYFAMLVFCYEVESFASRLNTPNASPVSKLLYLA
IYISLLSLVAGTFWYFRYLSWGMEGPKEDWKHLKLLESWRVSDDQYT
NT seq 2304 nt NT seq  +upstreamnt  +downstreamnt
atgtctacttctgttgaacccaatgaaacagaagctttgttgagaaagcagaatgaactt
tctacaactgcttcaattgaagaaaaataccctaatcaccaagaagatgaagatgaagtc
gatactcttaaacgaacccaatatgatgaagctaaagaaactgctgaatctttaaaacaa
gttgaatccattttggcacctattcttttcactgcattgtcatttttcgtgagattttat
cgtatttcagtgaatgatcatgttgtttgggatgaagctcattttggtaaatttggatcc
tattatttacgacacgaattttatcatgatgttcatcctccattgggtaagatgttagtt
ggtttatctggttatttggcagggtacaatggatcttgggatttcccaagtggtgaaaaa
tatccagattatattgattatactaaaatgagattgtttaatgccactttttctgccttg
tgtgttccattggcatatttcacagggaaagaaattggattttctatgtttactacttgg
ttattcactttaatggtggctcttgaatcaagttatgttacattaggtaaattcatttta
ttggattcaatgttgttatttttcactgttgctactgttttctgtttttctcgtttcaac
aattttaacaataaatcacaagaattttccagaaaatggtggaaatggattcttttaacg
ggtgtttccattggttgtacttgttcagttaaaatggttggattatttgttaccactttg
gtgggtatttacactgttgtcgatctttggaacaaattgagtgataaatctatttcatgg
acaaaatatattcaacattggtttgctagaattgttgccttgattattgtccctattttc
atctttatgctttcatttaaagttcattttgatttgttatataaatcaggtaccggtgat
gccaatatgtcatcacttttccaagctaatttggctggttccgatgttggtggtggtcct
cgtgaagtatctatgttccactcagttattactttaaagaaccaaggtttaagtggtgga
cttttgcattcacatgttcaaacattcccagaaggttccaaacaacaacaagttactact
tatggtcataaagattcaaacaacaattggattttccaaagagctagaggacaaccttat
tatgacacttcaggtaacactactgatgttgaatatatttttgatggtatgcatgtaaga
ttaatgcatccacaaactggtagaaacttacatactcatgacattcctgcaccagtctct
aaatctgaatatgaagttgcatgttatggtaatttaactattggtgatcctaaagataat
tggattgtggaaattatggaacaagcaagtgatgaagataagatgagattacatcctttg
acttcatcatttagattgaagaatgaagtgatgaattgttatttgggagttactggtact
actttacctcaatgggggtttagacaaggtgaagttgtttgttataaaaacccatttaaa
aaagacaaaagaacttggtggaatattgaaaataatcgtaatgcaattttaccaccagct
ccagaagatttcaaattacctaaaaccaaattcatccgcgatttcattcaattgaatttg
gctatgatggctactaataatgctttagttcccgacactgaaaagcaagatgatttggct
tcatcattttggcaatggccaacattaaatgttgggatcagaatgtgtggatggggacca
gaaaatcctaaatattatatgattggttcaccagcaactacttggacatctacttttggt
gttattttgtttgcatttattgttttgtattatttgattagatggcaaagacaatatgtt
gatttcccaagtactaatccacacaaattgaaattatttgtcatgggaggtatttatcca
atgtttggttgggggttacatttcttaccatttgccattatgggtagagttacctatgtt
catcattatgttcctgcactttattttgccatgcttgttttctgttatgaagttgaatca
tttgcttcaagattaaatacacctaatgcttctccagtgctgaaattattatatttggcc
atttatatcagtttgctttccttagttgctggtactttctggtatttcagatatttatct
tggggtatggaaggaccaaaagaagattggaagcatttgaaattattggaatcatggaga
gtctctgatgatcagtatacctag

DBGET integrated database retrieval system