KEGG   Corynebacterium diphtheriae VA01: CDVA01_0675Help
Entry
CDVA01_0675       CDS       T01702                                 

Gene name
echA2
Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cdv  Corynebacterium diphtheriae VA01
Pathway
cdv00071  Fatty acid degradation
cdv00280  Valine, leucine and isoleucine degradation
cdv00310  Lysine degradation
cdv00360  Phenylalanine metabolism
cdv00380  Tryptophan metabolism
cdv00410  beta-Alanine metabolism
cdv00627  Aminobenzoate degradation
cdv00640  Propanoate metabolism
cdv00650  Butanoate metabolism
cdv00903  Limonene and pinene degradation
cdv01100  Metabolic pathways
cdv01110  Biosynthesis of secondary metabolites
cdv01120  Microbial metabolism in diverse environments
cdv01130  Biosynthesis of antibiotics
cdv01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cdv00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CDVA01_0675 (echA2)
   00650 Butanoate metabolism
    CDVA01_0675 (echA2)
  Lipid metabolism
   00071 Fatty acid degradation
    CDVA01_0675 (echA2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CDVA01_0675 (echA2)
   00310 Lysine degradation
    CDVA01_0675 (echA2)
   00360 Phenylalanine metabolism
    CDVA01_0675 (echA2)
   00380 Tryptophan metabolism
    CDVA01_0675 (echA2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CDVA01_0675 (echA2)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CDVA01_0675 (echA2)
   00281 Geraniol degradation
    CDVA01_0675 (echA2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CDVA01_0675 (echA2)
   00627 Aminobenzoate degradation
    CDVA01_0675 (echA2)
   00930 Caprolactam degradation
    CDVA01_0675 (echA2)
Enzymes [BR:cdv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CDVA01_0675 (echA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEX82944
Position
709891..710667
Genome map
AA seq 258 aa AA seqDB search
MAQVEVRIDGHLMCVTVNRHEVRNALSAQMCDDITSALNNADEQARDTAAIRAVLIRSVG
TTFCAGADLGSTTQSDDAAEVTQSDFHDSLTRMLESVVSCGVPVIADIQGPAVGAGMQLA
LSCDLRLVHHAAWFKVPAASLGFALDGWTINRAQCLLGGGWARSIFLGGATLSAPQAVAT
GFALEIADSDSAIAYAHRVAGMAPLALRQLKSALNSADFEYALVGESRDLFAQCWASTDA
REGQLARKQKRDPVFTGR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcaggtagaggtgcgtatcgacggccacctgatgtgtgtcaccgtaaatagacac
gaggttcgcaacgcactttctgcacagatgtgcgatgatattacatctgctcttaataat
gcagatgagcaggcgcgtgacactgcagctattcgcgccgtgctcatccgttctgttggt
acgaccttttgtgccggagcagatttgggcagtaccacccaaagtgatgatgcggctgag
gtaacgcagtcggatttccatgactctcttacgcgcatgttggaatcggttgtttcctgt
ggagtcccagttattgctgatattcaaggaccagctgttggcgctggcatgcagctggca
ttgagctgcgacctgcgtttggttcatcatgctgcatggtttaaggtgccggcggcgtct
cttgggttcgcgctcgacggatggactattaatagggcacagtgtttgctgggcggcggt
tgggcgcgatcaattttcctgggcggcgcaacgctatcggcaccgcaggcggtggcaact
ggttttgcgctggagatcgctgattccgattctgcgattgcctatgctcatcgtgttgct
ggaatggcccccttggcgctgcggcaacttaaatccgcgctcaacagtgctgattttgaa
tatgcgcttgttggggaatctcgtgatctttttgcccaatgttgggctagtacggatgct
cgcgaagggcagctggctcgaaaacaaaagcgagatccggtatttactggtcgctga

DBGET integrated database retrieval system