KEGG   Corynebacterium diphtheriae VA01: CDVA01_1430Help
Entry
CDVA01_1430       CDS       T01702                                 

Gene name
trpC2
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cdv  Corynebacterium diphtheriae VA01
Pathway
cdv00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cdv01100  Metabolic pathways
cdv01110  Biosynthesis of secondary metabolites
cdv01130  Biosynthesis of antibiotics
cdv01230  Biosynthesis of amino acids
Module
cdv_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cdv00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CDVA01_1430 (trpC2)
Enzymes [BR:cdv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CDVA01_1430 (trpC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh OMPdecase QRPTase_C PDZ
Motif
Other DBs
NCBI-ProteinID: AEX83697
Position
complement(1536885..1537691)
Genome map
AA seq 268 aa AA seqDB search
MVTVFDEIIAGVVEDVAAREAQVSFQDIKAQSRLCAPPRDACGALLASGCGIIAEVKRAA
PGQGLLAEIPSPVDLALELESGGAALIACHTERRRFHGSLTEMAKIRRHVSVPVMCRDFI
VDPYQIHEARCYGADMVPLRVAALAQSRLVALIDRVESLGMAALVEVRDTAEASRALDAG
ARIIGVNARDFSTMTLNRAAFCEIAPGLPSDVVRVALSGVRNAKELLDYASAGADAVVIG
QSIVTAQSPRGATRALVAAGQHPSCPSR
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggttacagtcttcgatgagatcatcgctggtgtggtggaagacgttgccgcgcgcgaa
gcgcaggtttcattccaggacatcaaagcgcagtctcgtctgtgcgcgccacctagggat
gcttgtggagcattgttagcaagtggctgtggaatcatcgcggaggtcaaaagggcagca
cctggccaaggtttgcttgcggagattccttcgccggtagatctggctcttgagctcgag
tccggcggtgcggcgttgattgcttgtcacacagagcgccggcggtttcatggttctttg
acggagatggcaaagattcgtcgtcacgtgtccgttccagttatgtgtcgcgattttatt
gttgatccctatcagattcatgaagctcgctgctatggagctgatatggtgccgcttcgg
gtagctgcgcttgcgcagtcacgacttgttgcattgattgatcgggtggagtccctgggg
atggctgcgcttgtcgaggtgcgcgatactgcggaggcatctcgtgccttagatgctggt
gctcgaattatcggtgttaatgcgagagatttttctacgatgacccttaaccgagcggct
ttttgcgagatcgctccaggacttcctagcgacgtggtccgagtggcgctttcaggggtt
cgtaatgctaaagagcttttagactacgcctcggctggggcagacgccgtggtgattggc
caaagcatcgtgacggcgcaatcgcctcgaggggcgacgcgtgccttggttgctgcaggc
cagcatccctcgtgtccctcacgttag

DBGET integrated database retrieval system