KEGG   Corynebacterium diphtheriae VA01: CDVA01_1642Help
Entry
CDVA01_1642       CDS       T01702                                 

Gene name
ndk
Definition
(GenBank) nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
cdv  Corynebacterium diphtheriae VA01
Pathway
cdv00230  Purine metabolism
cdv00240  Pyrimidine metabolism
cdv01100  Metabolic pathways
cdv01110  Biosynthesis of secondary metabolites
cdv01130  Biosynthesis of antibiotics
Module
cdv_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
cdv_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
cdv_M00053  Pyrimidine deoxyribonuleotide biosynthesis, CDP/CTP => dCDP/dCTP,dTDP/dTTP
Brite
KEGG Orthology (KO) [BR:cdv00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CDVA01_1642 (ndk)
   00240 Pyrimidine metabolism
    CDVA01_1642 (ndk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cdv04131]
    CDVA01_1642 (ndk)
Enzymes [BR:cdv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     CDVA01_1642 (ndk)
Membrane trafficking [BR:cdv04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    CDVA01_1642 (ndk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: AEX83909
Position
complement(1761308..1761718)
Genome map
AA seq 136 aa AA seqDB search
MTERTLILIKPDGVERGLIGEIIARIERKGLKFSALDLRVADRETAEKHYAEHADKPFFG
ELVNFITSAPLIAGVVEGPRAIEAWRQLAGGTDPVAKATPGTIRGDFALEVSTNVVHGSD
SPESAEREISIWFPNL
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacgtaccctgattctgatcaagccagacggcgttgagcgcggcctcatcggt
gaaatcatcgcccgcatcgagcgcaaaggcctgaaattctccgctcttgacctgcgcgtt
gcagaccgcgagactgctgagaagcactatgcagagcacgctgacaagccattcttcggc
gagctggtgaacttcatcacctccgcaccactgatcgctggcgttgttgagggcccacgc
gctatcgaagcatggcgccaacttgctggtggcaccgacccagttgccaaggcaacccca
ggtaccatccgcggcgacttcgctcttgaggtgtccaccaacgtggttcacggttccgac
tccccggagtctgccgagcgcgagatctccatctggttccctaacctgtaa

DBGET integrated database retrieval system