KEGG   Corynebacterium diphtheriae VA01: CDVA01_2171Help
Entry
CDVA01_2171       CDS       T01702                                 

Gene name
trpC1
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
cdv  Corynebacterium diphtheriae VA01
Pathway
cdv00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cdv01100  Metabolic pathways
cdv01110  Biosynthesis of secondary metabolites
cdv01130  Biosynthesis of antibiotics
cdv01230  Biosynthesis of amino acids
Module
cdv_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cdv00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CDVA01_2171 (trpC1)
Enzymes [BR:cdv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CDVA01_2171 (trpC1)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     CDVA01_2171 (trpC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI
Motif
Other DBs
NCBI-ProteinID: AEX84435
Position
2368054..2369511
Genome map
AA seq 485 aa AA seqDB search
MQNDSSTRPMPTVLESIVSGRRSHLPEIQARISHVDPARLPRSTRSLFHALGGHSDGGPA
LRGSTRFIMECKSSSPSLGMIREDYHPGDIARVYSRYAAGISVLCEPDRFGGDYNHLATV
AATTHLPVLCKDFIIHPAQVHAARYFGADAILLMLSVLDDATYTELSQEAARLGLDVLTE
VIDEVEVERAIRLGATIFGINHRNLHDLSIDLNRSARLAQLIPDSAVIVSESGIRNNETV
RQLSGHSSAFLVGSQLTSQPDVDRAARELVYGLNKVCGLQSPSEAQAARASGAIYGGLIF
VESSPRNVSRETSKKIMAAEPDLTYVAVSRRTTGWTEIIGGNIAVAQIHSPYQGSIAAEK
ELINHVRGEVGDKVKIWRAVSMTHADGPLVAEALAPEVDSLVLDTGNGGTGTTFDWARIP
EAVKGKTLLAGGIGPDNVTEALAVGCAGLDLNSGLEYPVEAGKWAAHKDATAIHSTFTQI
RGFHY
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgcagaatgattcgtcgacacgccccatgcccaccgtcctagaatccatcgtttcgggc
cgacgatcccacctgcccgaaatccaagcgcggatttcccacgtggatccagcgcgacta
ccgcgttccacccgctccttgttccacgccttgggaggccatagcgatgggggtccggcg
ttgcgggggagtacgcgcttcatcatggagtgcaagtcctcctcgccgtcgcttggcatg
atccgcgaggactaccaccctggcgacatcgcgcgggtgtattcacgttatgcggccggc
atttcggtgttgtgcgagccggatcgttttggcggcgactataaccatctggccacggtg
gcggccacgacacatctgccggtgctgtgcaaggattttattatccaccccgcacaggtt
cacgcggcacgttattttggggcggacgcaattttgctcatgttgagtgtgcttgacgac
gccacctacaccgagctcagccaggaagcagcacgcttggggttggatgttctcaccgag
gttatcgacgaggttgaggtggaacgtgccattcggttgggggccacaatctttggcatt
aatcatcgcaatctgcatgacttgagcattgatttaaatcgctcagcacgccttgcgcag
ctgattcccgatagcgccgtgattgtctccgagtctggcattcggaataacgagacggtt
cgccaactcagcgggcattccagcgcattcttggtaggctcgcagcttacttctcagcca
gatgtggaccgtgcggcccgcgagcttgtgtacggcctcaataaggtgtgcggtttgcag
tcaccaagcgaggcgcaagcagcgcgcgcatcgggcgcaatctatggcggattaatcttc
gtggagtctagtccgcgtaatgtttcacgtgaaacatcgaaaaaaatcatggctgccgaa
cctgacctcacctatgtcgccgtctcacgacgcaccaccggatggaccgaaattataggt
ggcaacatcgccgttgctcagatccacagtccttaccagggctccatcgccgccgaaaaa
gaactcattaaccatgtgcgcggcgaggtaggagacaaggtaaaaatctggcgtgcagtc
tccatgacgcatgccgacggcccccttgtcgccgaagcactcgcaccggaggtagacagc
ctcgtcctcgacaccggcaacggcggaaccggcaccaccttcgattgggcacgcatccca
gaagccgtaaagggcaagactcttctcgccggcggcattggaccagacaatgtcaccgag
gcactcgccgttggctgcgcgggactcgatctcaactccgggttggaatatccagtcgaa
gcagggaagtgggcagcacacaaagacgctactgcaatccactccactttcacccaaata
cgtggttttcattactaa

DBGET integrated database retrieval system