KEGG   Corynebacterium diphtheriae VA01: CDVA01_2176Help
Entry
CDVA01_2176       CDS       T01702                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cdv  Corynebacterium diphtheriae VA01
Pathway
cdv00260  Glycine, serine and threonine metabolism
cdv00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cdv01100  Metabolic pathways
cdv01110  Biosynthesis of secondary metabolites
cdv01130  Biosynthesis of antibiotics
cdv01230  Biosynthesis of amino acids
Module
cdv_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cdv00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CDVA01_2176 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CDVA01_2176 (trpA)
Enzymes [BR:cdv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CDVA01_2176 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA IMPDH His_biosynth Amidohydro_2
Motif
Other DBs
NCBI-ProteinID: AEX84440
Position
2373164..2374000
Genome map
AA seq 278 aa AA seqDB search
MTRYTKLFSALSAKNEGAFVPFIMLGDPTPEASLAIIRTVVAAGADALELGVPFSDPVAD
GPTIQRSHLRALDNGTTVDSSLELIRQIRKEFPELPIGMLIYGNVAFTRGITQFYQEFAD
AGVDSILLPDVPVREGEPFIAAAKQPGIDPIFIAPAQASEATLEEVAQHSSGYIYAISRD
GVTGAERQSSTRGLDQVVANAKRFGGAPILLGFGISTPEHVRDAIAAGASGAITGSALTS
IIERHTTGTHPEPAQVTDLEALTEEIFTFVKDMKAATR
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgactcgctacaccaaattattctccgcactcagcgccaaaaacgaaggtgcattcgtc
cccttcatcatgctgggcgatcccaccccagaggcgtcgttagcaatcatccgtaccgtc
gttgccgcgggtgccgacgccctcgaactcggcgtccccttctccgacccggtagcagac
ggccccacaatccaacgctcccacctccgtgccctcgacaacggaaccaccgtcgatagc
tcgctggaactgatccgacagatccgcaaagaattccccgaacttcccatcggcatgctc
atctacggcaacgttgccttcacccgcgggatcacccagttctatcaagaattcgccgac
gccggcgtagactccatcctgcttcccgacgtccctgtccgcgaaggcgagcctttcatc
gcagctgccaagcaacctgggatcgaccccatcttcatcgcccccgcacaagcctcggaa
gcaaccttggaagaggtagcgcaacactccagcggatacatctacgccatctcccgcgat
ggtgtgaccggagccgaacgccaatcctctactaggggactagaccaagtggtggcaaat
gcgaaacgcttcggcggagcaccgatcctgctcggtttcggtatctccactcccgagcat
gtgcgcgacgccatcgcggcaggagccagcggcgccattacaggctccgcgctgacgtcg
atcatcgagcggcacaccacaggcacacacccagagccagcccaagtgacagaccttgag
gctctcaccgaagaaattttcacgttcgttaaagacatgaaagccgcaacccgttaa

DBGET integrated database retrieval system