KEGG   Corynebacterium diphtheriae PW8: CDPW8_1252Help
Entry
CDPW8_1252        CDS       T01701                                 

Definition
(GenBank) putative methylmalonyl-CoA mutase small subunit
  KO
K01847  methylmalonyl-CoA mutase [EC:5.4.99.2]
Organism
cdw  Corynebacterium diphtheriae PW8
Pathway
cdw00280  Valine, leucine and isoleucine degradation
cdw00630  Glyoxylate and dicarboxylate metabolism
cdw00640  Propanoate metabolism
cdw01100  Metabolic pathways
cdw01120  Microbial metabolism in diverse environments
cdw01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cdw00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CDPW8_1252
   00640 Propanoate metabolism
    CDPW8_1252
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CDPW8_1252
Enzymes [BR:cdw01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.2  methylmalonyl-CoA mutase
     CDPW8_1252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MM_CoA_mutase
Motif
Other DBs
NCBI-ProteinID: AEX69907
Position
complement(1298128..1299939)
Genome map
AA seq 603 aa AA seqDB search
MTDTRIAQTEELEAQRQEWYKAVAKVFARVQKKDVADIPLDIWQRLIRTTYDDIKVNPLY
NRADELEETQIPGAFPYTRGFAGAGQEEGVGWGVTESFGSSSSNKDVIHALDNGTTDVVV
YGEANIEELLKEVLFQYAPVRLNSGVATEEMANRLFSMVDAQGTVPRSIELGASPLSSMI
DGSASVDLDTAINLAVRASERENTRAILVDAVSFSNQGATDAQQIGLALAAGAEYLRGLI
AAGLSTEQALQQLSFRYAITDDQFAQISKLRAGRALWARVAEILGAKELGSAPQHALTAP
VMFTQRDPWVNMLRSTVAAFAAGVGGAKDVEVLCFDWAIAGGIPNVSRSFAHRIARNTNL
LLLEESHLGHVIDPAGGSYYVESLTSSIIEKAWKVFTDIEAAGGFLVAVENGSVKEMLDD
AHERVRRDIAHRIKKVTAINEFPNLAEAPLPAELRVEPTCVRRWAAEFESFRNRSDVFME
VNGKRPQAVLIPLGPLAKHNIRTGFITNLLGTGGIEALNPGQVVPGTPEFAEAAASAKIA
VICGTDAEYDATGAEALAELRKLGVETILLAGSPGHDFEPDDYLNMKIDAATKLDGLLKK
LGA
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
gtgactgacacacgaatcgcccaaactgaagagctcgaggctcagcgacaggaatggtat
aaagctgttgctaaagttttcgctcgcgtacagaaaaaagatgttgctgacattccgctc
gatatttggcagcgtcttattcgcaccacgtacgatgacatcaaagtcaaccctttgtat
aaccgtgcagacgaattagaagaaactcagattccaggtgcattcccatatacacgtggt
tttgctggcgcagggcaagaggaaggcgtcggctggggagtaaccgaatcgtttggttcg
tcttcttctaacaaagatgttattcatgcccttgacaatggcacaaccgatgtcgttgtt
tatggagaagccaacattgaagagctcctcaaagaggtgctttttcagtatgccccagtt
cgtctgaactctggtgtcgcgactgaagaaatggctaatcgtcttttctcgatggttgat
gctcagggtaccgtgccacgaagcatcgagcttggagcatcgccgcttagctccatgatc
gatgggtcagcctctgttgacctagacaccgcgattaacctagctgttcgcgcatctgag
cgtgaaaacactcgcgcgatcttggtcgatgcggtttccttctcaaatcaaggtgctacg
gatgcgcagcagattggtctcgcgctagcagccggcgcagaatatctccgtggcttgata
gctgcagggctctctacagagcaagctttacagcagctttcattccgttatgcaattacg
gacgatcagtttgctcaaatttctaaattgcgagcaggccgagcactctgggctcgagtt
gcagaaattcttggcgctaaagaactcggaagtgctccacaacatgcactgacggctcct
gtcatgtttactcagcgtgatccttgggtgaacatgttgcgttccacggtggcagcattc
gctgcaggcgttggtggcgccaaagacgtagaagttttgtgctttgactgggcaattgca
ggcggaattccaaatgtttcgcgcagcttcgctcaccgtattgcgcgtaatacgaacctt
ctgcttctcgaagaatctcacctaggtcatgtgattgacccagctggtggatcgtattac
gtcgaaagtctaacttcatcgatcatcgagaaggcatggaaggtcttcactgatatcgaa
gcagctggtggcttccttgtagccgtcgaaaacggttccgttaaagaaatgcttgacgat
gctcatgagcgagtacgccgtgatattgcgcatcgaatcaagaaggtcaccgcaatcaac
gaatttccaaatctcgcagaagcgccgttgccggcggagcttcgcgtagagccaacctgt
gtacgccgttgggctgcagaattcgagtcgttccgtaaccgctcggatgttttcatggag
gtcaacggaaaacggccacaagctgtactcatcccactaggcccacttgcaaagcacaat
attcgtactggttttattaccaatcttcttggtacaggcggaattgaggctttaaaccca
gggcaggttgttccaggaacccctgagtttgctgaggctgcggctagcgccaagattgca
gtcatttgtggcacggacgctgaatacgatgcaactggtgctgaggcattggctgaactg
cgcaagctcggtgtagaaaccattttgttagcgggatcgccaggacatgatttcgaaccg
gatgactatttgaacatgaagatcgacgcagctacgaagctcgatggtctactgaagaag
ttgggagcttaa

DBGET integrated database retrieval system