KEGG   Corynebacterium diphtheriae PW8: CDPW8_2088Help
Entry
CDPW8_2088        CDS       T01701                                 

Gene name
pitB
Definition
(GenBank) phosphate-transport permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
cdw  Corynebacterium diphtheriae PW8
Brite
KEGG Orthology (KO) [BR:cdw00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    CDPW8_2088 (pitB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 DUF4041
Motif
Other DBs
NCBI-ProteinID: AEX70731
Position
complement(2203190..2204791)
Genome map
AA seq 533 aa AA seqDB search
MTDSAMLSGAPFDQRSDKWWHLTFGGMLAVALIFFIAWSMGYVGSEANKAMLITTIAFGV
FMAFNIGGNDVANSFGTSVGAGTLSMKQALVIAAIFEVSGAVLAGGEVTDTVKSGIVDLG
AIDLDPQHFAFIMMASLLGAAVWLLVATKMGWPVSTTHSIVGGIVGASLLLGFTQGIGGW
EMVQWAEIGRIAMSWVLSPLLGGLCAWLLFGFIKKHILVYNEEADEALRQIKADRIELHQ
SFKASFERLNEIQQLAYTNAMTRDAALIQEPDFDPEQLESDYYRNLYRINTRRDNLNTHR
ALENWVPLLAAAGAALIGAMMLFKGLKNLNLHISNLGNVVILVMLSAVVWMAISIFSRLL
RQQELTRATFVLFSWMQVFTASAFAFSHGSNDIANAIGPFSAVLDVLRTDSINGKAAVPT
ALMVTCGISLIAGLWFIGRYVIHTVGTGLTKMHPASGFAAELSAAAVVMGASVIGLPVSS
THILIGAILGIGVVNKSANWRLMKPIGMAWIITLPAAAAVSGAAVFVLNAVWG
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgacggacagcgcgatgctcagtggcgctcccttcgatcagcgctccgacaaatggtgg
cacctcacctttggcggaatgctcgcagtggcgctgatcttcttcatcgcatggtccatg
ggatacgttggctccgaagccaacaaagccatgctgatcaccacgatcgccttcggcgta
ttcatggccttcaacatcggcggcaacgatgtggccaactcctttggcacctcggtgggt
gcgggaacactcagcatgaaacaagcgctggtgatcgccgcaatcttcgaagtatccggc
gctgtcctcgcaggcggcgaggtcaccgacacagtcaaatccggcatcgttgacctcggt
gccatcgacctcgacccccaacacttcgccttcatcatgatggcctcgctcctcggagcc
gcagtatggctcctcgtggccaccaagatgggctggccagtgtccaccacgcactccatc
gtcggcggtatcgtcggtgcctcgctgctcttgggctttacccaaggaatcggcggctgg
gagatggtgcaatgggcagaaatcggccgcatcgcgatgtcctgggtgctttcgccacta
cttggtggcctttgtgcgtggttgctcttcggctttattaaaaagcacattttggtctac
aacgaagaagccgacgaggcgcttcgtcagatcaaagccgaccgcattgagctgcaccaa
tccttcaaagcctccttcgagcgcctcaacgagatccagcagttggcctacaccaacgcc
atgactcgcgacgccgccttgattcaagaaccagacttcgacccagaacaactggagtct
gactactaccgcaacctgtaccgcatcaatacccgacgcgacaacctaaacacccaccgt
gcgttggaaaactgggtgccgctgctggctgctgcaggcgccgcccttatcggtgccatg
atgctgttcaaagggcttaagaacctcaacttgcatatcagcaacttgggcaacgtggtt
atcctcgtgatgctctccgcagtagtctggatggccatttcgatcttttcccgactgctg
cgccagcaagaactcacacgggcaacctttgtgctgttctcttggatgcaggtatttacc
gcctccgccttcgcgttctcccacggttcgaacgacatcgccaacgcaatcggaccattt
tccgcagtgctcgacgtcctccgcaccgactccatcaacggcaaagccgcagtgccaacc
gcactgatggtcacctgcggtatctcactgatcgccggcttgtggttcatcggccgctac
gtgatccacaccgtgggcaccggattaaccaagatgcaccctgcctccggcttcgcagct
gaactttccgccgcagcggtagtcatgggcgcatccgtcatcggcttgccggtgtcttcc
actcacatcttgatcggcgcgatcctcggtatcggtgtggtcaacaaatccgccaactgg
cggctcatgaagcccatcggcatggcgtggattatcaccctgccggctgcagccgcagta
tccggcgcagcagtgttcgtgctcaacgccgtgtgggggtaa

DBGET integrated database retrieval system