KEGG   Corynebacterium diphtheriae PW8: CDPW8_2335Help
Entry
CDPW8_2335        CDS       T01701                                 

Gene name
trpC1
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
cdw  Corynebacterium diphtheriae PW8
Pathway
cdw00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cdw01100  Metabolic pathways
cdw01110  Biosynthesis of secondary metabolites
cdw01130  Biosynthesis of antibiotics
cdw01230  Biosynthesis of amino acids
Module
cdw_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cdw00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CDPW8_2335 (trpC1)
Enzymes [BR:cdw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CDPW8_2335 (trpC1)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     CDPW8_2335 (trpC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI
Motif
Other DBs
NCBI-ProteinID: AEX70978
Position
2503335..2504765
Genome map
AA seq 476 aa AA seqDB search
MPTVLESIVSGRRSHLPEIQARISHVDPARLLRSTRSLFQSLGGRSDGGPALRGSARFIM
ECKSSSPSLGMIREDYRPGDIARVYSRYAAGISVLCEPDRFGGDYNHLATVAAATHLPVL
CKDFIIHPVQVHAASYFGADAILLMLSVLDDATYTELSQEAARLGLDVLTEVIDEVEVER
AIRLGATIFGINHRNLHDLSIDLNRSAHLAQLIPDSAVIVSESGIRDNETVRQLSGHSSA
FLVGSQLTSQPDVDRAARELVYGHNKVCGLQSPSEVQAARTSGAIYGGLIFEESSPRNVS
RETSKKIMAAEPELTYIAVSRRTTGWAEIIGDNIAVAQIHSPYQGSIAAEKELISHVRGE
VGDKVKIWRAISMTHADGPLVAEALAPKVDRLVLDTGNGGTGTTFDWARIPEAIKGKALL
AGGIGPDNVTEALAVGCAGLDLNSGLEYPAEAGKWATHKDAAAIHSTFTQIRGFHY
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccgtcctagaatccatcgtttcgggccgacgatcccacctgcccgaaatccaa
gcgcggatttctcacgtggacccggcgcgactactgcgttccacccgctcgctgtttcag
tcgttgggaggccgtagcgatggcggtccggcgttgcgggggagtgcgcgcttcatcatg
gagtgtaagtcctcttcgccgtcgcttggcatgattcgtgaggattatcgccctggcgac
atcgcgcgggtgtattcacgttatgcggccggcatttcggtgttgtgcgagccggatcgt
tttggtggcgactacaaccatctggccacggtggcggctgccacgcatcttccagtgtta
tgcaaggattttattatccaccctgtgcaggttcacgcggccagttattttggggcggac
gcaattttgctcatgttgagtgtgcttgacgacgctacctacaccgagctcagccaggaa
gcagcacgcttggggttggatgttctcaccgaggttatcgacgaggttgaggtggaacgt
gccattcggttgggggccacaatctttggcattaatcatcgcaatctgcatgatttgagc
attgatttgaatcgctcagcacaccttgcgcagctgattcccgatagcgccgtgattgtc
tccgagtctggcattcgggataacgagacggttcgccaactcagtggacactccagtgcg
ttcctcgtgggctcgcaacttacttctcagccagatgtggaccgtgcggcccgtgagctt
gtgtacggccacaataaggtgtgcggtttgcagtcgccaagcgaggtgcaagcagcgcgc
acatcgggtgcaatctatggcggattgatcttcgaggagtctagcccgcgtaatgtttca
cgtgaaacatcgaaaaaaatcatggctgccgaacccgaacttacctacatcgccgtctca
cgacgcaccaccggatgggccgaaatcataggtgacaacatcgccgttgctcagatccac
agtccctaccagggctccattgccgccgaaaaagaactcatcagtcacgtccgcggcgag
gtaggagacaaggtaaaaatctggcgcgcaatctccatgacgcatgccgacggaccactt
gtcgccgaagcactcgcacccaaggtagacagactcgtcctcgacaccggcaatggtgga
accggcaccaccttcgattgggcacgcatcccagaagccataaaaggcaaggctcttctc
gccggcggcattggaccagacaatgtcaccgaggcgctcgccgttggctgcgcaggactc
gatctcaactccgggttggaatatccagccgaagcggggaagtgggcaacacacaaagac
gctgctgcaatccactccactttcacccaaatacgtgggtttcattactaa

DBGET integrated database retrieval system