KEGG   Corynebacterium deserti: CDES_04700Help
Entry
CDES_04700        CDS       T04068                                 

Definition
(GenBank) gamma-glutamyltranspeptidase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
cdx  Corynebacterium deserti
Pathway
cdx00430  Taurine and hypotaurine metabolism
cdx00460  Cyanoamino acid metabolism
cdx00480  Glutathione metabolism
cdx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    CDES_04700
   00460 Cyanoamino acid metabolism
    CDES_04700
   00480 Glutathione metabolism
    CDES_04700
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cdx01002]
    CDES_04700
Enzymes [BR:cdx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     CDES_04700
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     CDES_04700
Peptidases and inhibitors [BR:cdx01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   CDES_04700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: ALC05384
UniProt: A0A0M4CHL4
Position
complement(964508..966484)
Genome map
AA seq 658 aa AA seqDB search
MAAFSVAALTLAISSCTSGSDSSASSASSSDASTTAASSDAATSTEASPPLAACELGSEV
TSDEAVEGTHSGEDISVAPEIGTGYREGMTPVETTGYAVATANPLASAAACEVLRDGGTA
ADALVTAQFVLGLTEPQSSGLGGGGYILYYDAESNAVTAIDGRETAPVAADENYLIHVSA
DDQSAPVPDARRSGRSIGVPGIVAALGQLHESFGQTSWQDVLASPQQLATDGFAISPRMS
ASIASSAEDLSHDPEAAEYFLDADGEAKTPGTILQNPDYAETVRLIAEGGADAFYTGEIA
ASIVERATREVDGFTPSLMSTADLAAYTPETREALCAPYRDKIVCGMPPSSSGGVTVMET
LGILNNFDLSQYPPTEVGLDGGLPDPEAIHLISEAERLAYADRDAYIGDPAFVEVPGGGV
NELISEDYTRTRSELITPEESMGEAEAGLTGSPAMAPLPESGTSHISIIDSYGNAASLTT
SVEAAFGSFHFTRGFILNNQLTDFSAEPLDDNGEPVANRVESAKRPRSSMSPMLVFNTSD
TGEISDLNMVLGSPGGSLIIQFVVKTLVNIIDWGMDPQQAVSAPNFGAMNQPQTGLGKEH
PLISANEDELVAELESKGHELNVTDQSSGLSALVKEGDTIVGGADPRREGVVLGGQTS
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgttctccgtggcagccctaaccctggccatttcctcctgcacctccggatca
gattcctctgcttcctctgcttcctcatccgatgcttcgacgactgcagcttcctccgat
gcagcaacatccactgaagcctcccctcccctcgcagcctgcgagctcggctctgaagta
acgtctgacgaagccgtcgaaggcacccactccggcgaagacatttccgtcgcccctgaa
atcggcaccggttaccgtgaaggcatgacacccgtggaaaccacgggctacgccgtcgca
accgcaaaccctttggcctctgccgctgcctgtgaagtcctccgcgacggcggcaccgca
gccgacgcactggtcaccgcacaatttgtccttggccttaccgaaccacaatcatctggc
ctcggcggtggtggatacattctctattacgatgcagaatccaatgcagtcactgccatt
gatggtcgcgaaaccgcaccggtagcagctgatgaaaactacctcattcacgtctcagcc
gacgatcaaagcgccccggtccccgatgcccgccgttccggtcgctccattggtgttccg
ggcatcgtcgcagcacttggccaattgcatgaatcctttggacaaacgtcctggcaggac
gtgctcgcgtctccacagcagcttgccactgatggttttgcgattagtccacgcatgtca
gcatccattgctagttctgcagaagatctctcccacgatcctgaggctgccgagtacttt
ctcgatgccgacggcgaagccaagacgcctggcacaatcttgcaaaatccggactatgca
gaaactgtgcgcctcattgcagaaggcggcgccgatgcgttttataccggcgaaatcgct
gcgagcattgtggaacgagccactcgagaggttgacggtttcaccccatccctgatgagc
accgccgatttagctgcgtacactccagaaacacgcgaagcattgtgtgcgccctaccgc
gacaagattgtatgtggcatgccaccatcatcgtcaggtggcgtcacagtgatggaaacc
ttaggtatcttgaacaactttgatttaagccaatacccacctactgaagttggattggat
ggcggacttcccgaccctgaagccattcacctgatctctgaggccgagcgtttggcctat
gcagaccgcgatgcgtatatcggagaccccgcttttgttgaagttccaggaggaggcgta
aacgagctgatcagcgaagactacacacgcactcgctcagaactgatcacacctgaagaa
tccatgggagaagccgaagccggattgacaggctcccctgcgatggcaccacttccggaa
agtggaacgagccacatttcgattatcgactcctatggcaatgctgcttctctgaccacc
agcgtcgaggctgcgtttggttccttccacttcacacgcggattcattttgaacaatcag
ctcactgacttctccgccgaaccactcgatgacaacggcgagccagtagcaaaccgcgtg
gaatctgccaaacgcccccgttcttccatgtcaccgatgttggtgtttaacacaagcgat
accggcgagatctctgacctcaatatggtgttgggttcccccggtggatcgctgattatt
cagttcgttgtgaagactttggtcaacatcattgactggggaatggatccacagcaggca
gtctccgctccaaactttggtgccatgaaccagccccaaacgggattgggcaaagagcat
ccactgatctcggcaaacgaagatgagctggttgcggagttagaaagcaaaggccacgag
ctcaatgtcactgatcaatcaagtggattgtcggcgttggtcaaagaaggcgacactatt
gttggcggcgcagatcctcgccgagaaggagttgtgctgggaggacagacttcttaa

DBGET integrated database retrieval system