KEGG   Corynebacterium deserti: CDES_05395Help
Entry
CDES_05395        CDS       T04068                                 

Definition
(GenBank) hypothetical protein
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
cdx  Corynebacterium deserti
Brite
KEGG Orthology (KO) [BR:cdx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cdx03009]
    CDES_05395
Enzymes [BR:cdx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     CDES_05395
Ribosome biogenesis [BR:cdx03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    CDES_05395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_12 Methyltransf_32 Methyltransf_31 Ubie_methyltran Methyltransf_23
Motif
Other DBs
NCBI-ProteinID: ALC05516
UniProt: A0A0M4CDE2
Position
1093332..1094198
Genome map
AA seq 288 aa AA seqDB search
MLSHIIDVLADPIDGTPLHGADDYSRLVSESGHSYDVARQGYVTLAGGAGLRYAGDDAQM
IADRETFLSGGHFAPFVETVSEHVHSAIDAAGLDDDDQPVICEIGAGTGYYLSHTLDSVA
GSRGIGIDVSVHAAKHLAKCHPRVGAVVADAWARLPIADSSVDAITVVFAPRNAVEFARI
LKPSGQVIVLTPEIGHLSELREPLGIIDVEAGKVDRMIEQAAGHLKPVGESDLVEFEMML
DQQSIASQIGMSPSARHIKPEALAERIKALPEHMKVTARARVTRLQRL
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
gtgctttcccacatcattgatgttcttgctgatccaattgatggcaccccactacatggt
gcagatgattattcccgattggtgtcagaatccggacattcttacgatgtagcccgccag
ggatatgtcacactggcaggtggcgccggtcttcgatatgcaggcgatgacgcccagatg
atcgcagaccgggaaactttcctttccggtggacactttgctcccttcgtggaaacggtc
tctgagcacgtgcacagtgccatcgatgctgctggtttggacgatgatgatcagccggtg
atctgcgaaatcggtgctggcaccggttactacctgtcccacaccttggattctgtggcg
ggatcccgtggcattggcattgacgtgtccgtgcacgctgccaagcacttagctaagtgc
catcctcgagtgggcgctgtggttgcggatgcgtgggctcggctgcccatcgcggacagc
tctgttgatgccatcaccgtggtgttcgcaccgcgcaacgctgtggaatttgctcgcatt
ctcaagccatccggacaggtgatcgtgttgacccctgagattggccatctgtctgagctg
cgcgagccccttggcatcatcgatgtggaggctggcaaggtggatcgcatgattgagcag
gctgcaggccaccttaagccagtgggtgagagtgatctcgtggagtttgagatgatgctt
gatcagcagtcgatcgcctctcagattggtatgagcccttctgcgcgccacatcaagcca
gaggcgctggcagagcgcattaaggcgttgcccgagcacatgaaggtgaccgctagggcg
cgggtcacgcgccttcagcgcctttaa

DBGET integrated database retrieval system