KEGG   Corynebacterium deserti: CDES_08350Help
Entry
CDES_08350        CDS       T04068                                 

Gene name
thrS
Definition
(GenBank) Threonine-tRNA ligase
  KO
K01868  threonyl-tRNA synthetase [EC:6.1.1.3]
Organism
cdx  Corynebacterium deserti
Pathway
cdx00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:cdx00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CDES_08350 (thrS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cdx01007]
    CDES_08350 (thrS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cdx03016]
    CDES_08350 (thrS)
Enzymes [BR:cdx01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.3  threonine---tRNA ligase
     CDES_08350 (thrS)
Amino acid related enzymes [BR:cdx01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   CDES_08350 (thrS)
Transfer RNA biogenesis [BR:cdx03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    CDES_08350 (thrS)
 Prokaryotic type
    CDES_08350 (thrS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2b HGTP_anticodon tRNA_SAD
Motif
Other DBs
NCBI-ProteinID: ALC06075
UniProt: A0A0M4CXP2
Position
complement(1710253..1712313)
Genome map
AA seq 686 aa AA seqDB search
MNTPDTAVHNLVVFEVPAGTAIGAAMRELDLPNKGPEAIVCAKDAEGNLKDLSHVPETTA
QFTAVPANTDDGRAVIRHSCAHVLAQAVQAEFPGTKLGIGPAIENGFYYDFDAAEPFTPE
DLKTIEKRMKKIIKTGQKFERRVYESAEAAAEELKNEPYKLELIQDKGNVDPNSDEATEV
GAGELTAYDNVNPRTSEVEWSDLCRGPHIPTTRYIPAFALTRSSAAYWRGDQANAGLQRI
YGTAWESKEKLDEYQTMLAEAEKRDHRRLGTELDLFSFPDDLGSGLPVFHPNGGIVRNEM
EDHSRRRHIAAGYSFVNTPHITKQDLYERSGHLGFYKDGMFPPMQVDAEYDDEGNETKPG
QEYYLKPMNCPMHNLIFDSRGRSYRELPLRLFEFGTVYRYEKSGVIHGLTRARGFTQDDA
HIYCTEDQLEEELTTVLDFILSLLRDYGLDDFYLELSTRDPKKSVGSDEIWERSTDILSR
VATKSGLELVPDPEGAAFYGPKISVQARDAIGRTWQMSTVQLDFNMPERFNLEYTSSDGS
KKQPIMIHRALFGSIERFFGVLLEHYAGAFPAWLAPHQVMGIPVADDCIPHLEAVSAKLR
AKGIRADVDTSDDRMQKKIRNHTTGKVPFMLLAGARDVEADAVSFRFLDGTQVNGVPVDE
AVALIASWIGERINDQPSEETIAARR
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
gtgaacactccagataccgcagtacacaacctcgtcgtttttgaggttcccgcaggtacc
gccatcggtgcagcaatgcgcgaactcgatctccccaacaagggaccagaggccattgtg
tgtgcaaaggatgcagaaggaaacctcaaagacctttcccacgtcccagaaactactgca
cagttcaccgcagtacctgccaacactgacgacggccgagcagtcatccgccactcctgc
gctcacgttctggcacaggccgtccaggcagagttcccaggcaccaagttgggcatcggc
ccagccattgaaaacggtttctactacgactttgatgcagcagaacccttcaccccagaa
gatctcaagaccattgagaagcggatgaagaagatcattaagaccggccagaagtttgaa
cgccgcgtctacgaatccgccgaagctgctgcggaagaactgaaaaacgagccctacaaa
ctggagctgatccaggacaagggcaacgtcgatcccaactctgatgaagcaaccgaagtt
ggagcaggtgaactaaccgcctacgacaacgtcaacccacgcacaagcgaagtggaatgg
tccgatctctgccgtggtcctcacattccaaccactcgttacattccagcattcgccttg
acccgttcctctgctgcctactggcgtggcgatcaggctaacgctggcctccagcgcatt
tacggcaccgcatgggagtccaaggaaaagcttgacgagtaccaaactatgcttgcagag
gcggaaaagcgtgaccaccgccgtctaggcactgagcttgacctgttctcattccccgat
gatctgggctccggtttgcccgtattccaccccaacggtggcatcgtgcgcaatgagatg
gaagaccactcacgccgccgccacattgcggctggctactcgtttgtgaacaccccacac
atcaccaagcaggacctttacgagcgttccggacacctcgggttctacaaggacggcatg
ttcccacctatgcaggtggatgctgaatatgacgacgagggcaatgagaccaagccaggg
caggagtactacctcaagcccatgaactgcccaatgcacaacttgatcttcgactcccgt
ggacgctcctaccgagagttgccactacgtcttttcgagtttggcactgtctaccgctat
gagaagtccggtgttatccatggactcacccgtgcccgtggcttcacccaggatgatgcg
cacatttactgcaccgaggatcagctggaagaagagctgaccaccgtgttggacttcatc
ctttccttgctgcgtgactacggcctggatgatttctacctggagctatctacccgcgat
ccaaagaagtccgttggttctgatgagatctgggagcgatccactgacatcttgagccgc
gttgccaccaagtccggcctggagcttgttccagacccagagggtgccgcgttctacgga
ccaaagatttctgttcaggctcgcgacgccatcggtcgtacctggcagatgtccaccgtg
cagctagacttcaacatgcccgagcgcttcaacctggagtacacctcctctgatggatcc
aagaagcagcccatcatgattcaccgcgcgctgtttggctccatcgagcgcttcttcggc
gtgctgctcgagcactacgcgggcgcattcccagcatggctcgcaccacaccaggtcatg
ggcatccctgttgctgatgattgcatcccacacctggaggctgtctctgcgaagctgcgc
gccaaaggtatccgcgccgatgtggacacctctgatgaccggatgcagaagaagatccgc
aaccacaccaccggcaaggtgccgttcatgttgctagctggtgcccgcgacgtggaagct
gacgctgtgagcttccgcttcttggacggcactcaggtcaacggcgtgcctgtcgatgaa
gcggtggcgcttatcgcctcctggattggtgagcgcatcaatgaccagccaagcgaggaa
accattgcagctcgcaggtag

DBGET integrated database retrieval system