KEGG   Corynebacterium deserti: CDES_10880Help
Entry
CDES_10880        CDS       T04068                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cdx  Corynebacterium deserti
Pathway
cdx00071  Fatty acid degradation
cdx00072  Synthesis and degradation of ketone bodies
cdx00280  Valine, leucine and isoleucine degradation
cdx00310  Lysine degradation
cdx00362  Benzoate degradation
cdx00380  Tryptophan metabolism
cdx00620  Pyruvate metabolism
cdx00630  Glyoxylate and dicarboxylate metabolism
cdx00640  Propanoate metabolism
cdx00650  Butanoate metabolism
cdx00900  Terpenoid backbone biosynthesis
cdx01100  Metabolic pathways
cdx01110  Biosynthesis of secondary metabolites
cdx01120  Microbial metabolism in diverse environments
cdx01130  Biosynthesis of antibiotics
cdx01200  Carbon metabolism
cdx01212  Fatty acid metabolism
cdx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cdx00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CDES_10880
   00630 Glyoxylate and dicarboxylate metabolism
    CDES_10880
   00640 Propanoate metabolism
    CDES_10880
   00650 Butanoate metabolism
    CDES_10880
  Lipid metabolism
   00071 Fatty acid degradation
    CDES_10880
   00072 Synthesis and degradation of ketone bodies
    CDES_10880
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CDES_10880
   00310 Lysine degradation
    CDES_10880
   00380 Tryptophan metabolism
    CDES_10880
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CDES_10880
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CDES_10880
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CDES_10880
Enzymes [BR:cdx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CDES_10880
Exosome [BR:cdx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CDES_10880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ALC06551
UniProt: A0A0M4CKN2
Position
2250355..2251581
Genome map
AA seq 408 aa AA seqDB search
MNPQDIVICSPLRTPVGAYGGSFKGIPVQDLATTVVNAIVDATGITGDDVDDLILGQASP
NGAAPALGRIVALDSKLGLDVPGMQIDRRCGSGLQAIVTAGAHVAAGAADLIIAGGAESM
SRTEYTVSGDIRWGVKGGDMQLRDRLAEARETAGGRNHPIPGGMIETAENVRREFGISRE
EQDELAAASQHRWGKAADEGLFDDEIVPVTVPAKKRGQEPTIVARDEHGRPDTTVEKLSS
LRPIMGRQDAEATVTAGNASGQNDGAAAVIVTTRAKAEEKGLKPMMRLAGWAVAAVPPET
MGIGPVPATKKVLERLGLTLDDIGAIELNEAFASQALAVLKKWGVSWKDERVNPIGSGIS
MGHPVGATGARMTVTLAHRMQRENTQYGLATMCIGGGQGLAAIFEKED
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaaccctcaagacattgtcatttgttctccactgcgcaccccagttggtgcttacggc
ggatccttcaagggcatccccgtgcaggatttggccaccaccgtggtcaacgccatcgtt
gatgccaccggaattaccggcgatgacgttgatgatttgatcctcggccaggcctccccc
aacggcgctgctcctgcactgggtcgcattgttgcgctggattccaagcttggcctggac
gttcctggcatgcagattgatcgtcgttgtggttctggcctgcaggcaattgtgaccgct
ggtgcgcacgtggctgcaggtgctgctgacctcatcatcgcaggtggcgcggaatccatg
agccggactgagtacaccgtgtctggcgatatccgttggggtgtcaagggcggggacatg
cagcttcgtgatcgtttggctgaggctcgtgagaccgcgggcggacgtaaccacccgatt
cctggcggcatgattgaaactgcggagaatgtgcgccgtgagttcggtatttcccgcgag
gagcaggacgagctggcagcagcgtcgcagcaccgctggggcaaggcagcagacgagggg
cttttcgacgacgagatcgtgccggttactgttcctgcgaaaaagcgtggtcaagagcct
acgattgttgctcgcgatgagcatggacggccggatacgaccgtcgaaaagcttagctcc
ttgcgcccgattatgggccgtcaggatgcggaggcaacggtgaccgcgggtaatgcgtct
ggccaaaatgatggcgctgcggcggttatcgtgaccacccgcgcgaaggctgaagagaag
ggcctgaagccaatgatgcgtcttgctggctgggctgttgcagctgtgcctccagagacc
atgggtattggacctgttcctgcaaccaagaaggtcctcgaacgtttggggctgaccttg
gatgatatcggagctatcgagctcaatgaggcgtttgcttcccaggccttggcagtactg
aagaaatggggtgtgtcgtggaaggatgagcgcgtcaaccccattggttctggtatctcc
atgggtcacccagtcggcgccactggtgcgcgcatgactgttaccctggcgcaccgtatg
caacgtgaaaacacccagtacggccttgccaccatgtgcattggtggcggtcagggtctg
gctgcaatatttgagaaggaagactaa

DBGET integrated database retrieval system