KEGG   Corynebacterium deserti: CDES_13950Help
Entry
CDES_13950        CDS       T04068                                 

Gene name
thlA
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cdx  Corynebacterium deserti
Pathway
cdx00071  Fatty acid degradation
cdx00072  Synthesis and degradation of ketone bodies
cdx00280  Valine, leucine and isoleucine degradation
cdx00310  Lysine degradation
cdx00362  Benzoate degradation
cdx00380  Tryptophan metabolism
cdx00620  Pyruvate metabolism
cdx00630  Glyoxylate and dicarboxylate metabolism
cdx00640  Propanoate metabolism
cdx00650  Butanoate metabolism
cdx00900  Terpenoid backbone biosynthesis
cdx01100  Metabolic pathways
cdx01110  Biosynthesis of secondary metabolites
cdx01120  Microbial metabolism in diverse environments
cdx01130  Biosynthesis of antibiotics
cdx01200  Carbon metabolism
cdx01212  Fatty acid metabolism
cdx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cdx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CDES_13950 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    CDES_13950 (thlA)
   00640 Propanoate metabolism
    CDES_13950 (thlA)
   00650 Butanoate metabolism
    CDES_13950 (thlA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CDES_13950 (thlA)
   00072 Synthesis and degradation of ketone bodies
    CDES_13950 (thlA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CDES_13950 (thlA)
   00310 Lysine degradation
    CDES_13950 (thlA)
   00380 Tryptophan metabolism
    CDES_13950 (thlA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CDES_13950 (thlA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CDES_13950 (thlA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CDES_13950 (thlA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cdx04147]
    CDES_13950 (thlA)
Enzymes [BR:cdx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CDES_13950 (thlA)
Exosome [BR:cdx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CDES_13950 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ALC07115
UniProt: A0A0M4CID7
Position
2929516..2930700
Genome map
AA seq 394 aa AA seqDB search
MTDNKIVFLGGARTAVGTFGGTLAKVPTHELGAHAMKAALSRSNVPAEKIDEVIIGCVGQ
VGEEAFLARRIALKAGARDDSNAMTVNRLCGSGLQAVQSAALELRSGDSKYVVAGGAENM
SLQPFLDYGARDGWRLGSRTLIDGTQSLVTDPFGNYPMGNTAEAVAAEFNVSRKDQDEFA
AESQRRAAAAQEAGFFNEEIEAIEVKERHNTVIFDKDEHPRAGSTFEKLSTLRPAFIKDG
TVTAGNSSGINDAAAALVMTTASTAHDDGLSPIGELVAFARAGIRPEIMGYAPKLATERV
LEKAGLTTEDMDWIEVNEAFAAQAVAVVRDLGLDPEKVNPLGGAIALGHPVGATGSILTL
RTLIQMKRTGGELGLITMCIGGGQAVAAIVRVLN
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgactgacaataaaatcgtattcctcggtggtgctcgcacagcggtaggcaccttcggt
ggaactcttgcaaaggttcccactcatgagctcggcgcacacgccatgaaagcagcattg
tctcgttcgaatgttcctgcagaaaagattgacgaagtcatcattggctgtgttggtcag
gttggtgaagaagcattcttagctcgtcgcatagctcttaaggccggtgcgcgcgatgat
tccaatgccatgaccgtcaaccgcttgtgtggctccggattgcaagcagtacagtctgca
gcacttgaactgcgttctggagattccaagtatgtcgtcgccggtggcgcagagaacatg
tcgttgcagccattccttgattatggcgctcgcgacggatggcgattgggtagccgtacg
ctcatcgatggcacccaatctctcgtcactgatccttttggaaactatcccatgggcaac
accgctgaagctgtagctgcagagttcaacgtctcccgcaaagaccaggatgagttcgcc
gctgaatcacaacgtcgcgcagcagcagctcaagaagctggcttcttcaacgaagaaatc
gaagccattgaggtcaaggaacgccacaataccgtcattttcgacaaagatgagcaccct
cgtgcaggcagcacgtttgaaaaactcagcacccttcgtcctgctttcatcaaagacgga
accgtcaccgctggaaactcatctggcatcaatgacgccgcagctgccctggtcatgacc
actgcaagcaccgcccatgatgatggcctttcaccaatcggcgagcttgttgcattcgcc
cgtgccggtatccgaccagagatcatgggatacgccccaaagctcgcgactgaacgcgtt
ctagaaaaagcaggtctgaccaccgaagatatggactggattgaggtcaatgaggctttc
gctgctcaagccgtggcagttgttcgagatctcggtttggatcctgaaaaagtcaaccca
ctcggaggtgcaattgcactcggccacccggttggtgcaacgggatcaattctcaccctt
cgtactctcatccagatgaaacgaaccggtggagagctcggtctgatcaccatgtgtatt
ggtggaggacaagccgtcgcagcgattgttcgtgttcttaactaa

DBGET integrated database retrieval system