KEGG   Corynebacterium diphtheriae 31A: CD31A_0772Help
Entry
CD31A_0772        CDS       T01697                                 

Definition
(GenBank) hypothetical protein
  KO
K17489  methylmalonyl-CoA carboxyltransferase 12S subunit [EC:2.1.3.1]
Organism
cdz  Corynebacterium diphtheriae 31A
Pathway
cdz00640  Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:cdz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CD31A_0772
Enzymes [BR:cdz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.1  methylmalonyl-CoA carboxytransferase
     CD31A_0772
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Syntaxin-6_N DUF3294
Motif
Other DBs
NCBI-ProteinID: AEX41451
Position
767909..768172
Genome map
AA seq 87 aa AA seqDB search
MSDLNNEQLLQLVNELSARLDSAESEIKELRKRSDASIPEDVIIAISAAVSAFLGNRGKI
KAVKYSRHRTWAAQGRQSVQHHIPGTL
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatttaaacaacgagcaactgcttcaactagtcaacgagttaagcgcgcgcctc
gattccgcagaatcagagatcaaagagttgcgtaagcgctctgatgcgtccatcccagaa
gacgtcatcatcgcaatttctgcagcagtctccgcattcttgggtaaccgaggcaagatc
aaggccgtgaagtactcgcgtcaccgcacgtgggccgctcagggtcgtcagagcgtccag
catcatattccgggcacgctgtaa

DBGET integrated database retrieval system