KEGG   Corynebacterium diphtheriae 31A: CD31A_1318Help
Entry
CD31A_1318        CDS       T01697                                 

Gene name
tpi
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cdz  Corynebacterium diphtheriae 31A
Pathway
cdz00010  Glycolysis / Gluconeogenesis
cdz00051  Fructose and mannose metabolism
cdz00562  Inositol phosphate metabolism
cdz01100  Metabolic pathways
cdz01110  Biosynthesis of secondary metabolites
cdz01120  Microbial metabolism in diverse environments
cdz01130  Biosynthesis of antibiotics
cdz01200  Carbon metabolism
cdz01230  Biosynthesis of amino acids
Module
cdz_M00002  Glycolysis, core module involving three-carbon compounds
cdz_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cdz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CD31A_1318 (tpi)
   00051 Fructose and mannose metabolism
    CD31A_1318 (tpi)
   00562 Inositol phosphate metabolism
    CD31A_1318 (tpi)
Enzymes [BR:cdz01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CD31A_1318 (tpi)
Exosome [BR:cdz04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CD31A_1318 (tpi)
  Exosomal proteins of bladder cancer cells
   CD31A_1318 (tpi)
  Exosomal proteins of melanoma cells
   CD31A_1318 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM BCSC_C DUF4129
Motif
Other DBs
NCBI-ProteinID: AEX41993
Position
complement(1348014..1348796)
Genome map
AA seq 260 aa AA seqDB search
MARTPLIAGNWKMNLDHLQAVATVQKLAFALPKEYYEKVDVAVTVPFTDLRSVQTLIEGD
KLAITYGAQDVSQHEAGAYTGEISAQMLAKLGCTWVVVGHSERREYHGESSELVAVKAKA
ALNQGISPIVCVGEPLEIREAETHVEYVVEQTRASLAGLTADDLAKTVIAYEPVWAIGTG
KVASAADAQEVCAAIRNLIIELAGKEVAEGLRILYGGSVKAETVAEIVGQPDVDGGLVGG
ASLDGEAFAKLAANAATVVD
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtactccacttatcgcaggaaactggaagatgaatcttgatcatcttcaagct
gttgcaactgtgcaaaaacttgcttttgcacttccaaaggaatactacgaaaaagtcgac
gtagctgtcaccgtaccttttactgatcttcgctctgttcaaacacttatcgaaggcgat
aagctcgctataacttatggtgctcaagatgtttcgcagcacgaggctggtgcctacact
ggtgaaatctctgcccagatgcttgccaaactcggatgtacttgggttgttgttgggcac
tcagagcgtcgtgagtaccatggcgaatcttcggagcttgttgcagtcaaagctaaagct
gcgttgaaccaaggaattagccccatcgtatgtgttggagagccccttgaaattcgtgaa
gctgaaacacacgtagaatatgtcgtcgaacagactcgcgcatcgttggcgggtcttacc
gcagatgatttggcaaagactgttatcgcctacgaacccgtatgggctattggtacgggt
aaagtagcatccgctgccgatgcacaggaagtctgcgcagcaattcgtaacctcatcatt
gagcttgctggtaaagaagtagctgaagggcttcgcattctttatggcggatcagttaaa
gcagaaacagtagccgagatcgtaggtcaaccggatgttgatggcggcttagtgggtggc
gcttctcttgacggtgaagcattcgccaaactagcagctaatgcagcaactgttgtcgac
tag

DBGET integrated database retrieval system