KEGG   Corynebacterium diphtheriae 31A: CD31A_1780Help
Entry
CD31A_1780        CDS       T01697                                 

Gene name
proB
Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
cdz  Corynebacterium diphtheriae 31A
Pathway
cdz00330  Arginine and proline metabolism
cdz00332  Carbapenem biosynthesis
cdz01100  Metabolic pathways
cdz01130  Biosynthesis of antibiotics
cdz01230  Biosynthesis of amino acids
Module
cdz_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cdz00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CD31A_1780 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    CD31A_1780 (proB)
Enzymes [BR:cdz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     CD31A_1780 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AEX42447
Position
complement(1841866..1842996)
Genome map
AA seq 376 aa AA seqDB search
MNAQHSSADLRDVIRNAKRIVVKIGSSSLTGENFEVSPGRIDRIVEALEDRMRRGSDVIV
VSSGAVAAGMAPLGLTSRPKDLATKQAAASVGQVHLANAWGNSFARYNRTIGQVLLTASD
AGQRDRARNAQRTIDRLRLLHAVPVINENDTVATSEMHFGDNDRLAAIVSHLVSADALVL
LSDVDGLYDKNPADPSARFVSEVRDGNDLKGVIAGDGGAVGTGGMASKVSAARLASRSGV
PVLLTSADYVAEALGDAEVGTVFYPKDDRLSAWKFWALYAADTGGALRIDAGAVAAVTAG
GNSLLAVGITEVIGDFHAGEIVEILGPEGEIIGRGEVAYDSAVLTTMLGKQTAQLPEGLQ
RPVVHADYLSDYASRA
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcccagcacagtagcgccgatctgcgtgacgtgattagaaacgctaagcggatt
gtggtcaagattggttctagttcactgaccggcgaaaattttgaggtttctccgggtcgt
atcgaccgcattgtggaggctctagaagatcgtatgcggcgcggttccgacgtgattgtt
gtatcttctggtgctgtggctgctggtatggctccattggggttgacttcgcggccgaag
gatttggcaacaaagcaagctgctgcctcggtggggcaggtgcatttggctaatgcgtgg
ggtaatagttttgcccgttataaccgcacgattggccaagtgctgttaacggcctccgac
gcaggccagcgggatcgtgcgcgtaatgcgcagcgcactattgatcgcttgcggttgcta
cacgcagtgccggttattaatgagaatgacacggttgcaacctctgagatgcactttgga
gacaacgaccgccttgccgcgattgtgtcgcacctagtgtccgcggacgcattggtgctg
ctctcggacgtagatgggttgtatgacaaaaaccctgcggatccttcggcacgatttgtg
tctgaagtcagagacggcaacgacctgaaaggtgtgatcgcaggcgatggtggggccgtg
gggaccggtggcatggcgtcgaaggtgtcggctgcgcggttggcgtcgcgaagcggcgtg
cccgttttgttgacctccgctgattatgtggccgaggcgctgggcgatgctgaggtgggt
acggtgttttaccccaaggatgatcgcctatcggcgtggaagttttgggcgctgtacgct
gcagatactggcggtgcattgcgtatcgacgccggcgcggtcgccgcagtcaccgccggc
ggaaactccctgctggccgtgggaattaccgaggtcattggcgatttccacgctggtgag
atcgtggagatcctaggcccagaaggtgagatcattggtcgaggtgaggtggcctatgat
tccgcagtgctcaccaccatgctgggcaaacaaaccgcgcagctgcccgagggtctgcaa
cgtcccgtggtccatgctgattatctttccgattacgcgtcacgcgcgtaa

DBGET integrated database retrieval system