KEGG   Corynebacterium diphtheriae 31A: CD31A_2366Help
Entry
CD31A_2366        CDS       T01697                                 

Definition
(GenBank) hypothetical protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
cdz  Corynebacterium diphtheriae 31A
Pathway
cdz00010  Glycolysis / Gluconeogenesis
cdz01100  Metabolic pathways
cdz01110  Biosynthesis of secondary metabolites
cdz01120  Microbial metabolism in diverse environments
cdz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cdz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CD31A_2366
Enzymes [BR:cdz01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     CD31A_2366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AEX43031
Position
complement(2496971..2497753)
Genome map
AA seq 260 aa AA seqDB search
MSDQIADARLVPLGAILTRMSTIVDMPETRGHLISAITTASDPGEILYLSSRADFSEGGS
IRGGVPIIAPWFAKNLGHDELQHGWARRVEWETIPTNGGIDARTSHDDWDLRLGTQVLPH
GFAMMLKARNASPLRRDFQSAFHPYFRVADVRTTTVTVGDQEFRFDGTAVDQAVPLPEWT
PLVIKDSQRTITVTYQGADHAVVWNPGSELAAQMTDVGEGEWTEFVCVEPALLGDHAQGI
SVPPWDWVEIGMTVKVTPAQ
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgatcaaattgcagacgcgcggctcgtgccgttgggggctatccttacaagaatg
agcaccattgtagatatgcctgagactcgtggacatttgatatctgcgattactaccgcc
agcgatcctggcgagattctttacttatccagtcgcgcggatttttccgagggtggttcg
atccgtggtggtgtcccgatcatcgcaccgtggtttgctaagaacttggggcacgatgag
ttgcagcatggttgggcgcgccgggtggagtgggagacgatccctaccaatggcggtatc
gacgcccgcacgagccacgatgattgggatctgcgccttggcacgcaggtacttcctcat
ggttttgccatgatgttgaaggcccgcaacgcttccccactgcgtcgcgatttccaatcc
gcgttccacccgtatttccgcgttgctgacgtgcgcaccaccaccgtaacggtgggcgat
caggagtttcgtttcgacggcaccgccgtcgaccaagcggttcctctgccagagtggacg
ccgctggttatcaaggattcccagcgcactattactgtcacctaccaaggtgccgatcat
gctgtggtgtggaatcctggcagcgagcttgccgcacagatgacagatgtgggcgaaggt
gaatggaccgagtttgtttgtgtagaaccagcattgttgggtgaccacgcccaaggtatt
tctgttcccccttgggattgggtagagatcggcatgaccgtgaaagtcacaccggctcag
taa

DBGET integrated database retrieval system