KEGG   Cellvibrio sp. PSBB023: B0D95_01145Help
Entry
B0D95_01145       CDS       T04725                                 

Gene name
metG
Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ceb  Cellvibrio sp. PSBB023
Pathway
ceb00450  Selenocompound metabolism
ceb00970  Aminoacyl-tRNA biosynthesis
ceb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ceb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    B0D95_01145 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    B0D95_01145 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ceb01007]
    B0D95_01145 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ceb03016]
    B0D95_01145 (metG)
Enzymes [BR:ceb01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     B0D95_01145 (metG)
Amino acid related enzymes [BR:ceb01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   B0D95_01145 (metG)
Transfer RNA biogenesis [BR:ceb03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    B0D95_01145 (metG)
 Prokaryotic type
   Other AARSs
    B0D95_01145 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AQT58846
UniProt: A0A1U9N6K1
Position
complement(249857..251881)
Genome map
AA seq 674 aa AA seqDB search
MTQLPQRKILVTSALPYANGSIHLGHLVEYIQTDIWVRFQKLRGVDCTYVCADDAHGTAI
MLKAEQLGHSAEQQIANVKAEHEADFAAFNIGFDNYHSTHSTENHELSNMIYGRLKANGH
IATKSITQAYDPEKQLFLADRYIKGTCPKCKTEDQYGDNCEKCGATYSPMDLINPKSAIS
GATPVAKESEHFFFTLPEFSDFLKGWTRAGHLQDEVANKMAEWLDAGLQSWDISRDAPYF
GFEIPGEPGKYFYVWLDAPIGYIASLKNLLDKKGEDWYEYWKPDSTAEVYHFIGKDIVNF
HALFWPAMLHSANLRTPTKICVHGFLTVNGTKMSKSRGTFINARTYLDHLNPEYLRYYFA
AKLTSNVDDIDLNLEDFIQRVNSDLVGKVVNIASRTAKFINNAGGVLAADIADAELWQKF
IDAGETIANYYESRDYSKAMREIMALADAANEYIATQEPWKLAKQPGAEAQTQAVCTLGI
NMFRALLTYLKPVLPALTADAEVFLGETLSWNAPVSFRAGEKINEFKPLLTRVEKDKVDA
MIEAGKEALAAAAPKAEGPLVDEPIAAEIDFNDFAKVDLRIALIANAEHVEGSDKLLRLT
LDLGGETRNVFSGIKSAYDPKDLVGKLTVVVANLKPRKMKFGMSEGMVLAAGPGDKEIYL
LEPHTGAKPGQRVM
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgactcaattgccgcaacgtaaaatactggtcaccagcgccctgccctatgccaatggc
tccatccaccttggtcatttggtggagtacatccaaacggatatttgggtgcgcttccaa
aaactgcgcggtgtggattgcacttacgtctgtgcggacgatgctcacggtacggcgatc
atgctcaaagcggagcagttgggtcattcggcggagcagcaaatcgccaacgtaaaagcc
gaacatgaggcggattttgccgcctttaatataggtttcgataattatcactccacccac
agtaccgagaaccacgaactctcgaacatgatttatggccgcctgaaagccaacgggcat
atcgcgaccaaaagcattacccaggcttacgatccggaaaagcaactcttcctcgccgac
cgctacatcaaaggcacctgcccgaaatgtaaaaccgaagaccagtatggcgataactgc
gagaagtgcggcgcgacctattcgcctatggatttgatcaatccaaaatcagcaatttcc
ggcgcaacaccggttgccaaagagtcggagcacttcttttttaccctgcccgaattcagc
gatttcctgaaaggctggacccgtgccggtcatttgcaggatgaagtcgccaacaagatg
gccgagtggctcgacgccggtttgcaatcctgggatatctcccgcgatgccccctacttc
ggctttgaaattcccggcgaacctggcaagtacttttatgtgtggctggatgcgccgatc
ggctatatcgccagtttgaaaaacctgctcgataagaaaggggaagattggtacgaatac
tggaaaccggattccaccgccgaggtgtatcactttattggcaaagacatagtcaacttc
catgccctcttctggcccgcgatgctgcactcggccaatttgcgcacacctaccaaaatc
tgcgtgcacggcttcctgaccgtgaacggcaccaagatgagtaaatcgcgcggcaccttt
atcaatgcgcgcacttacctcgaccatttgaatccggaatatttgcgctattacttcgcc
gccaagctcaccagcaatgtggacgatatcgacctgaacctggaagattttatccagcgc
gtgaattcggatctggtgggcaaagtggtgaatatcgccagccgtaccgccaagttcatt
aataacgccggtggcgtgttggccgctgacattgctgatgccgagctgtggcaaaagttt
atcgatgccggtgaaaccatcgccaactattacgaaagccgcgattacagcaaagccatg
cgcgaaattatggcgctggccgatgcggccaacgaatatatcgctacgcaagagccgtgg
aaattagccaagcagccgggcgccgaagcgcaaacccaagccgtatgcaccttgggcatc
aatatgttccgcgcgctgctgacttacctcaaaccagtcttaccggcgctgactgccgat
gcggaagtctttttgggtgaaaccctgagctggaatgcgcctgtcagcttccgcgcaggc
gagaaaatcaacgagttcaaaccactgctcacccgtgtagaaaaagacaaggtagacgcc
atgattgaagccggtaaagaagcactcgccgccgcagcgcccaaggcggaaggtccattg
gtcgatgagccgattgccgccgaaatcgactttaatgattttgccaaggtagatttacgt
atagccctgatcgccaatgcagagcatgtagaaggttccgacaaattgctgcgtttaacg
ctggatttgggtggcgaaacccgcaatgtgttctccggcattaaaagcgcctacgacccg
aaagatctggtcggcaagctcaccgtcgtagtagccaacctcaaaccgcgcaaaatgaag
ttcggtatgagcgaaggcatggtgctggcggctggccccggcgataaagagatttatttg
ctggaaccgcataccggtgccaagcctgggcaacgcgtgatgtag

DBGET integrated database retrieval system