KEGG   Cellvibrio sp. PSBB023: B0D95_04205Help
Entry
B0D95_04205       CDS       T04725                                 

Definition
(GenBank) bifunctional 3-demethylubiquinol 3-O-methyltransferase/2-polyprenyl-6-hydroxyphenol methylase
  KO
K00568  2-polyprenyl-6-hydroxyphenyl methylase / 3-demethylubiquinone-9 3-methyltransferase [EC:2.1.1.222 2.1.1.64]
Organism
ceb  Cellvibrio sp. PSBB023
Pathway
ceb00130  Ubiquinone and other terpenoid-quinone biosynthesis
ceb01100  Metabolic pathways
ceb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ceb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    B0D95_04205
Enzymes [BR:ceb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.64  3-demethylubiquinol 3-O-methyltransferase
     B0D95_04205
    2.1.1.222  2-polyprenyl-6-hydroxyphenol methylase
     B0D95_04205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_23 Methyltransf_11 Methyltransf_25 Methyltransf_31 Methyltransf_12 CMAS Ubie_methyltran NodS MTS PrmA TPMT Methyltransf_9 Methyltransf_32 MetW Methyltransf_18 AdoMet_MTase SAM_KSR1 TehB
Motif
Other DBs
NCBI-ProteinID: AQT59384
UniProt: A0A1U9N7H9
Position
complement(931692..932396)
Genome map
AA seq 234 aa AA seqDB search
MANVDTAEIAKFEALASRWWDKNSEFKPLHDINPLRANFIDERSPVAQRKLIDVGCGGGI
LAESLAQRGAQVTGIDMGEAPLAVARLHALESGVELTYEQITAEDKAAQMPGAFDVVTCM
EMLEHVPDPASVVRACAQLVKNGGDVYFSTINRNPKSYAFAIVGAEYILKLLPKGTHEYS
KFIRPSELAQWLRAAGLELQSMTGMTYNPITKHYKLNPNDVSVNYLMHAKKVSD
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggccaatgtcgatactgctgaaattgcaaaatttgaagcacttgccagccgctggtgg
gataaaaacagcgaatttaaaccgctacatgacataaatcccttgcgcgccaactttatc
gatgagcgctcaccggttgctcaacgcaagttgattgatgtgggttgcggcggcggcatt
ttggcggagtcactggcgcagcgcggcgcacaagtcaccggtattgatatgggcgaagca
ccactggccgttgcacgcttgcatgctctggaaagcggtgttgaattgacctacgaacaa
atcaccgcggaagacaaagcagcgcaaatgcccggcgcatttgatgtagttacttgcatg
gaaatgctggaacacgtgcccgacccggcatcggttgttcgcgcctgtgcccaactcgtc
aaaaacggtggcgatgtgtatttttccactattaaccgcaacccaaaatcctatgccttc
gccattgttggcgccgaatatattttaaaactgctccccaaaggtacgcacgaatacagc
aagttcatccgcccgtccgaactggcccaatggttacgcgccgccggccttgagttgcaa
tccatgaccggcatgacctataaccccatcaccaaacattacaaactcaacccgaatgat
gtcagcgtgaattatttaatgcatgccaaaaaagtgagtgattaa

DBGET integrated database retrieval system