KEGG   Cellvibrio sp. PSBB023: B0D95_08215Help
Entry
B0D95_08215       CDS       T04725                                 

Definition
(GenBank) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
ceb  Cellvibrio sp. PSBB023
Pathway
ceb00860  Porphyrin and chlorophyll metabolism
ceb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ceb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    B0D95_08215
Enzymes [BR:ceb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     B0D95_08215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 AAA_26 CbiA MobB BPL_N
Motif
Other DBs
NCBI-ProteinID: AQT60077
UniProt: A0A1U9N980
Position
complement(1851857..1853326)
Genome map
AA seq 489 aa AA seqDB search
MPLGKTLMVQGTTSDAGKSTLVAALCRILKNRGISVAPFKPQNMALNSAVTVDGGEIGRA
QALQAQAAGLEPHTDMNPILIKPTSDTRAQIIVQGRAITDMDAAVYHHYKTEAMGYVLDS
FARLQQQYNVIVVEGAGSPAEINLRERDIANMGFAEAVDCPVILIADIDRGGVFAHLVGT
LELLSESERKRVVGFVINRFRGDISLLQSGLDWLEQKTGKPVLGVIPYLQGLYLDAEDAL
TTSSSSNADALLNVAVLALPRISNHTDFDPLRLHPQINFHWVGPNQQVPPCDLLIIPGSK
NTRADLDFVRAQGWESAIQTHLRYGGKLLGICGGFQMLGEQIHDPEGVESAPGSSSGLGY
FSMHTQLQRDKILLQRHGFLWDKNTPVVGYEIHTGISSGDALLQPACYFQNADGLVPDGA
ISQDKAIIGTYLHGLFDRPETLQQLLLWAGVTKAEVVDINQQREISIERLAKEVEAVFAA
DFLDQWSPT
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgccacttggcaaaacactaatggtacaaggcaccacatctgatgcaggtaaatccact
ctggtggcagcgctttgtcgtattttgaaaaatcgcggtatatcagtggcaccgtttaag
ccccagaatatggcattgaattctgcggtgacggttgatggcggtgaaatcgggcgtgcc
caggcattgcaggcacaagctgccgggcttgaaccccatacagacatgaatccgatcctg
attaaacccaccagcgatacccgcgcacaaattattgtgcaaggtcgggcaattaccgat
atggatgctgcggtttatcaccattacaaaactgaagccatgggttatgtgctggattcc
tttgcgcgcttgcaacagcagtacaatgtgattgtggtggaaggcgctggcagtccggct
gaaattaatttgcgcgagcgcgatattgccaacatgggttttgcggaggcggtggattgc
ccggttattttaattgccgatattgatcgcggtggtgtgtttgcccatttggtagggacg
ctggaattgctgagtgagtctgaacgtaaacgtgttgtgggttttgtgattaatcgcttt
cgtggtgacatcagtttattgcaatcgggcctggactggcttgaacaaaaaaccggtaag
ccggtgctgggcgtgatcccttatttgcaaggcctgtatctggatgcggaagacgcttta
accacctcatcatcatccaacgccgatgcgttgttaaatgttgcagtactggcgttgccg
cgtatttccaatcacacggattttgatccgctgcgactgcatccgcagattaattttcac
tgggttggccctaatcagcaggttcctccttgcgatttattgattattcctggcagtaaa
aatacccgtgccgatctggattttgtacgggcccaaggttgggaaagtgcgattcagacg
cacctgcgctatggcggcaagctgttggggatttgcggtggttttcaaatgttgggcgag
cagattcatgacccggagggtgtagagtctgcgccggggagttccagcggtttgggctat
ttttccatgcatacccaattacaacgcgacaaaatattgctgcagcgtcacgggttctta
tgggataaaaacacgccggttgtcggttatgaaattcacacggggataagtagcggcgat
gcgctgctgcaacctgcctgttatttccagaacgccgatgggctggtgccggatggggcg
ataagccaggacaaggctattataggaacctacctgcacggcctatttgaccggcccgag
acattgcagcaacttttgctctgggctggtgtgaccaaggcagaagtggtggatattaat
cagcaacgtgaaatatctattgagcgattggccaaggaagtggaggctgtgttcgcagcc
gatttccttgaccagtggtcaccaacctga

DBGET integrated database retrieval system