KEGG   Cellvibrio sp. PSBB023: B0D95_11115Help
Entry
B0D95_11115       CDS       T04725                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
ceb  Cellvibrio sp. PSBB023
Brite
KEGG Orthology (KO) [BR:ceb00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    B0D95_11115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 CARDB DUF4354
Motif
Other DBs
NCBI-ProteinID: AQT60562
UniProt: A0A1U9NA80
Position
complement(2542048..2542425)
Genome map
AA seq 125 aa AA seqDB search
MNKMSPIQVSVKTTYIAAQSEPLVHRYVYAYTITIANQGDVAAQLISRHWLITDANEKRQ
EVQGIGVVGEQPHIKPGESYTYTSGVILETETGIMEGSYQMRADDGSMFDATIPTFALVP
PHAIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaatgtctcccattcaggtatcggtaaaaacgacttatattgccgcccaatct
gagccgctagtgcatcgttatgtgtatgcctataccatcactattgccaatcaaggtgat
gtggcagcacagttaattagtcgccattggctgatcaccgatgccaacgaaaagcggcaa
gaagtgcagggcattggtgtggtgggcgagcagccgcacatcaagccgggtgaaagttac
acctacactagcggcgttattcttgaaactgagacgggcattatggaaggaagttatcaa
atgcgtgccgatgatggctcgatgtttgatgccactattccaacctttgcactcgtgcct
ccccatgcgattcattaa

DBGET integrated database retrieval system