KEGG   Cellvibrio sp. PSBB023: B0D95_16920Help
Entry
B0D95_16920       CDS       T04725                                 

Definition
(GenBank) phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
ceb  Cellvibrio sp. PSBB023
Brite
KEGG Orthology (KO) [BR:ceb00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    B0D95_16920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Phage_holin_5_2 DUF2101
Motif
Other DBs
NCBI-ProteinID: AQT61607
UniProt: A0A1U9NDQ4
Position
complement(3939532..3940806)
Genome map
AA seq 424 aa AA seqDB search
MTLFAEYGHVLFILACAFGLFMAWGIGANDVSNAMGTSVGSRALTMKQAICIAMVFEFAG
AYLAGGEVTETIRSGIVELDVMTQHPDLFVFGMLASLLAAGSWLLIASILGWPVSTTHSI
VGAIIGFAAVGISADAVQWNQVWGIVASWVTSPLAAGILSFWIFRSVQYLILDTEDPFAN
AKRYIPFYMFAVGFFLSMVTLLKGLKYVLKSHHVEFSFLQSVMIAVAIGLVVAAIGTYLL
SRISQDKSADKNNRFSSVERVFGVLMIFTACSMAFAHGSNDVANAVGPMAAVISVIQSGE
VGAKAAVAPWVLLLGGVGIVVGLATYGYKVMQTIGKKITELTPSRGFAAEMAAAATVVIA
SGIGMPISTTHTLVGAVLGVGLARGIGALNLRVIGGIFASWVITLPAGAGLSILYFFFFK
GVFS
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgactttatttgctgaatacggccatgtgctgtttattctagcctgtgcttttggcctg
tttatggcctggggcataggtgccaacgatgtatccaacgccatgggtacctcggttggc
tcacgcgcacttaccatgaagcaagccatttgtattgcaatggtatttgaatttgcaggg
gcctatctggccggtggcgaagtcactgaaactatccgcagtggtattgttgagctggat
gtaatgacccagcacccggatttattcgtttttggcatgctggcctcgcttctggcagca
ggtagttggctgttaattgccagtattttaggctggccggtatcaaccactcactctatc
gtgggcgccattattggctttgcggcagtcggtatctcggctgatgcggtgcagtggaat
caggtatggggaattgttgccagttgggtcacatcgccgctggcagcaggcattctgtca
ttctggatctttcgttcagtgcagtatttaatcctggatactgaagatccctttgctaat
gccaagcgctatatccctttctatatgtttgccgtgggtttctttttatccatggtcacc
ctgcttaaagggctgaaatatgtacttaagtcccaccatgtcgaattcagtttcctccag
tccgttatgatcgccgtggcgattggtctggtcgtcgcagcaataggtacctacctgtta
agccgcatcagtcaggataaaagtgctgacaaaaacaatcgcttctccagcgtagagcgc
gtatttggcgttttaatgatttttaccgcctgctctatggcatttgctcatggctccaac
gatgttgccaatgctgtcggccctatggccgcggttatcagtgttattcagtctggcgaa
gtcggcgccaaagcagctgtcgccccatgggttctattacttggcggtgtaggcatagtg
gttggcttggcaacctatggttataaggtcatgcaaaccatcggtaaaaagattacagaa
ctcacaccaagccgtggttttgccgccgaaatggccgctgccgccacagtggtaatcgcc
tccgggattggtatgcccatctcaaccactcacacactggtgggcgccgtgctgggtgtt
ggtttggctcgcggcattggcgcgctgaacttacgtgtgatcggcgggattttcgcctcc
tgggtaatcacccttcccgccggggcaggcttatcgatcctctacttctttttcttcaaa
ggtgtattcagctaa

DBGET integrated database retrieval system