KEGG   Cellvibrio sp. PSBB023: B0D95_20300Help
Entry
B0D95_20300       CDS       T04725                                 

Definition
(GenBank) asparaginyl/glutamyl-tRNA amidotransferase subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
ceb  Cellvibrio sp. PSBB023
Pathway
ceb00970  Aminoacyl-tRNA biosynthesis
ceb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ceb00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    B0D95_20300
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ceb03029]
    B0D95_20300
Enzymes [BR:ceb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     B0D95_20300
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     B0D95_20300
Mitochondrial biogenesis [BR:ceb03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    B0D95_20300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-ProteinID: AQT62562
UniProt: A0A1U9NEY6
Position
complement(4699877..4700164)
Genome map
AA seq 95 aa AA seqDB search
MAVDRSDIAKLAKLARIQITDEAADEAAKSISDVLALVDQLQAVNTDGVLPMAHPLDAVQ
RLRADVVTEPNQRDAFQAIAPATQDGLYLVPQVIE
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atggctgtagaccgttccgatatcgccaagctggccaagctggcgcgtatccagattacc
gatgaggccgccgatgaagcggcaaaaagtatttccgacgtgctggctctggttgatcaa
ttacaagccgtcaataccgatggcgtactgcccatggcgcaccccttggatgcggttcaa
cgcttgcgcgccgatgtggtcaccgagcctaaccagcgcgacgctttccaggccatagcc
cccgccacgcaagatggcttgtatctggtgccacaggttatcgaatag

DBGET integrated database retrieval system