KEGG   Cardinium endosymbiont of Sogatella furcifera: CE557_732Help
Entry
CE557_732         CDS       T05597                                 

Definition
(GenBank) Secreted/periplasmic Zn-dependent peptidases insulinase-like
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
cec  Cardinium endosymbiont of Sogatella furcifera
Brite
KEGG Orthology (KO) [BR:cec00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cec01002]
    CE557_732
Enzymes [BR:cec01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     CE557_732
Peptidases and inhibitors [BR:cec01002]
 Metallo peptidases
  Family M16: pitrilysin family
   CE557_732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M16_M Peptidase_M16 Peptidase_M16_C DUF480
Motif
Other DBs
NCBI-ProteinID: AXI24527
UniProt: A0A345PPJ3
Position
1:complement(939933..942794)
Genome map
AA seq 953 aa AA seqDB search
MKKILLSLFMYTSALANEPYQIIQDKSNLPLLNPSLQKRKTAKLCLNNGLEVYLISDELA
DQSAAALSIKTGSWQDPEAYPGTAHFLEHMLFMGTKKYPDEDAFDRFIKDNGGECNAYTA
SDHTVYSFSIHHPSFDQAIDYFSHFFIDPLFNPSSVARELQAVEQEYAKNIENDAWRRYM
ICKELGNPDHPNRWFSIGNAQTLSKIPQDELRKWYQENYSANLMKLVVYSPKPIDTLKKL
ITDTFSEIPNRKVEPFTINKPLSSDQQLGHFIYIQPVKNIQHLYLDWELPASFAVDETKT
AELLAYTINQGQKNSLLEILKKEGLAENLQASTGKIGHHNALFEIDITLTDQGVAQMPLV
MQRCFETLAGLRNMQLPTYLFEEMRKVSKRSYQYQTRKDPFAFVMDHARDLLYESLATYP
AKTVLPSSYRSEKFQSLLQVLQPENGQYYIVADSKKTKVATDQKEKWMGGAYAVRKVPEA
LLLSWKTIAPNPHIALPQPNPFMPSKLALLPKHKELAPVKIVDNKKGKVFYFKDNLYDTP
EVVHLMHIKSPLIDGTAQSASLMDLYLQFSKDKLSPILSCAAAAGLEANFGHARNSFKIT
ISGFSDKAAVLLKEILKELKHHTPQKRDFDLYISKLSKIYENAAKQLPIQQAIEKLCSLL
QKTNSTSKEKLTALHRLTYEDFLSFHSKLFEKSYIEGFFSGNLTRQEAKRCWLDMQHILG
YAAFPKHLHPKEEVLCLADQGPFVVEEKTTAQGNGIILTIDQGPFSFEKQAAQGILSIAL
QEAFFTTLRTKQKTGYIVQSLHQEIEKRLFQCFGVQSNSHQCQDLLYRFELFLEDFLQEM
PHDISAERFEKIRANYLLTLENLFPNLQDKSAWLDTFAFERNGDFNWLEKRMQAAKKLTY
DQFVEYANQFLSRANRKRLALSVSGKLPENHNFTYKEIEATQILKHGKYLTNQ
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatccttttatctctttttatgtatacttctgccttggccaatgaaccttac
caaattatccaagataaatctaaccttcctttgcttaatccttccttacaaaagcgaaaa
acagcaaagctttgcttaaataatggcctggaggtctatttaatttccgatgaactggcc
gatcaatcagcagcagctttaagcataaaaactggttcttggcaagatccagaagcatat
cctggaacggcccattttctcgaacatatgttgtttatgggaactaaaaaatatccagat
gaggatgctttcgatcgttttataaaagataatggaggagaatgtaatgcgtatactgct
tcagatcatacggtctattcattttccattcaccatccatctttcgatcaagcgatcgat
tatttttcccatttttttatagaccctctttttaacccatcatctgtggcaagagaattg
caggcagtcgagcaagaatatgcgaaaaatattgaaaatgatgcatggcgcagatatatg
atttgtaaagaattaggcaatcctgatcatcccaaccgatggttttcgataggcaatgcg
caaacactttctaagattcctcaagacgaactccgtaaatggtaccaagaaaactacagc
gctaacctaatgaagctcgtggtctattcccctaaacctatagatacattaaaaaaactc
attaccgatactttttctgagattccaaatagaaaagttgaaccttttacaataaacaaa
cctttatcttctgaccaacagctgggccactttatctatattcagcctgtcaagaatatt
cagcatctatatctagactgggagcttcctgcttcatttgcagtggatgaaacaaagaca
gcagagctccttgcttataccatcaatcaaggacaaaaaaatagtcttttagaaatccta
aaaaaagaaggactagctgaaaatcttcaagcttcgacaggtaaaatagggcatcataat
gctttgttcgaaatagatataaccttaacagaccaaggcgtagcacaaatgccacttgtg
atgcaacgttgttttgaaacattagctggtctaagaaatatgcagcttcctacttacctt
tttgaagaaatgcgtaaggtatctaaacgctcttatcaatatcaaacccggaaagatcct
tttgcatttgttatggaccacgctagggatcttctatatgaatcccttgccacttatcca
gcaaaaactgtactacccagttcctatagatctgaaaaattccaatctcttttacaggtt
ttacaacctgaaaatggccaatactatattgtagccgattctaaaaaaacaaaagtggca
accgatcaaaaagaaaaatggatgggaggtgcctatgcagttcgcaaagtacctgaagca
ctcctattatcgtggaaaacgattgcgcctaatccacatattgcgctaccccaaccgaac
ccctttatgccttccaagttagcactgcttccaaaacataaagagctagcgccagtaaaa
atagttgataataaaaaaggtaaagttttttatttcaaagacaatctctatgatacgccg
gaagtagtgcacttgatgcatatcaagagtccgcttattgatgggaccgcacagagtgcc
agcttaatggatctttatcttcagtttagtaaagataaactctctcctatcctttcttgt
gcagcagcagcaggtttagaagccaattttggccatgctcggaacagttttaaaatcact
atttcgggatttagcgataaagccgccgttctgcttaaagaaattttaaaagaattaaag
catcatactccccaaaaaagagactttgatctctatatttctaaactttctaagatttac
gaaaatgcagcaaagcaattgccaatacaacaggctatcgaaaaactgtgtagtttgctt
caaaaaacaaacagtacctcaaaggaaaaattaacagcacttcataggcttacttatgaa
gattttctatcattccattccaaactttttgaaaagagttatattgaaggctttttctca
gggaacttgactaggcaagaggcaaaaagatgctggttggatatgcaacatattctaggt
tatgctgcttttccaaagcatcttcatccaaaagaagaggtgctttgccttgctgatcag
ggcccttttgtagtagaggaaaagactacagcacaagggaatggcatcatcttaacgatt
gaccaaggacctttttcctttgaaaaacaagcagcacaaggcattctttccatagcttta
caagaagcattttttacaaccctacggaccaagcaaaaaacaggatatattgtccaaagt
ttgcatcaagagatagaaaagagactatttcaatgttttggtgtacaatccaattcgcat
caatgccaagatctgctctatcgatttgagctctttttagaagattttcttcaagagatg
ccccatgatatttctgctgaacgatttgaaaaaattagagcaaactatctgctgacccta
gaaaatctatttcctaacctacaagataaatcggcttggttagatacctttgcctttgaa
cgtaatggagactttaattggctagaaaagaggatgcaagcggcaaaaaaactcacttac
gatcaatttgtagaatatgccaaccaatttctatccagggcaaatcggaaacgacttgcc
ctctctgtatctggaaaacttccagaaaatcataactttacctacaaagaaatagaagct
acacagatcttaaaacatggaaaatatctcactaaccaataa

DBGET integrated database retrieval system