KEGG   Dickeya solani ND14b: LH89_05850Help
Entry
LH89_05850        CDS       T03347                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ced  Dickeya solani ND14b
Pathway
ced00020  Citrate cycle (TCA cycle)
ced00310  Lysine degradation
ced00380  Tryptophan metabolism
ced01100  Metabolic pathways
ced01110  Biosynthesis of secondary metabolites
ced01120  Microbial metabolism in diverse environments
ced01130  Biosynthesis of antibiotics
ced01200  Carbon metabolism
Module
ced_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ced_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ced00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LH89_05850
  09105 Amino acid metabolism
   00310 Lysine degradation
    LH89_05850
   00380 Tryptophan metabolism
    LH89_05850
Enzymes [BR:ced01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     LH89_05850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AIR68756
Position
complement(1355897..1357123)
Genome map
AA seq 408 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDSVQRDEVLVEIETDKVVLEVPAIEAGVLEVV
LEAEGATVTSRQVLGRLRPGDNSGKETSEKAQSKESTPAQRHTAGLEDENNDALSPAIRR
LIAEHDLDAAAIKGSGVGGRITREDVEKHLAAQKPAGKKADAPAAAPAPSAPSLGNRSEK
RVPMTRLRKRVAERLLEAKNSTAMLTTFNEINMKPIMDLRKQYGEAFEKRHGIRLGFMSF
YIKAVVEALKRFPEVNASIDGEDVVYHNYFDVSIAVSTPRGLVTPVLKDVDLLGMAEIEK
KIKELAVKGRDGKLTVEELTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMA
VDGQVVILPMMYLALSYDHRLVDGRESVGFLVTVKEMLEDPARLLLDV
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattcttgtccctgacctgcctgaatcggtagccgatgcgactgtg
gctacctggcacaagaaaccgggcgacagcgtccagcgtgatgaagtgctggttgaaatt
gaaaccgacaaagtcgtgctggaagttcctgcgattgaagccggtgtgctggaagtggtg
ctggaagcggaaggcgccaccgtaacgtcccgtcaggtactggggcgtttgcgtcccggc
gacaactctggcaaggaaaccagcgaaaaagcgcagagcaaagaatcgacgcccgcacag
cgtcatacagccgggctggaagatgagaataacgatgccctgagtccggctatccgtcgt
ctgattgccgagcacgatctggacgcggctgccatcaagggcagcggcgtgggcggccgt
atcactcgtgaagacgtggaaaaacacctggctgctcaaaaaccggctggcaaaaaggcg
gatgcgcctgccgcagcaccggctccatctgcaccgtcactgggcaaccgcagcgagaaa
cgcgtccccatgacccgtctgcgcaagcgcgtggccgagcgtctgctggaagccaaaaac
agcaccgccatgctgaccacgttcaacgaaatcaacatgaagccaatcatggatctgcgc
aagcagtatggcgaggcgttcgagaaacgtcacggcattcgcctgggcttcatgtccttc
tatatcaaggccgttgtggaagccctgaagcgcttcccggaagtgaatgcgtccattgat
ggcgaagatgtggtttaccacaactactttgacgtcagcatcgcggtgtcgaccccgcgc
ggtctggtgacgccggtgctgaaagatgtcgatctgctgggtatggccgagatcgagaag
aaaatcaaagaactggcggtgaaaggccgtgacggcaaactgaccgtcgaagagctgacc
ggcggtaacttcaccatcaccaacggtggcgtgttcggttccctgatgtcgaccccgatc
atcaacccgccgcagagcgcgattctggggatgcacgccatcaaggatcgcccgatggcg
gtggatggtcaggttgtgattctgccgatgatgtacctggcgttgtcctacgatcatcgt
ctggtcgacggccgtgaatcggtcggtttcctggttaccgttaaagagatgctggaagac
ccggcccgcttgctgctggatgtctaa

DBGET integrated database retrieval system