KEGG   Dickeya fangzhongdai ND14b: LH89_06185Help
Entry
LH89_06185        CDS       T03347                                 

Definition
(GenBank) hydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
ced  Dickeya fangzhongdai ND14b
Brite
KEGG Orthology (KO) [BR:ced00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LH89_06185
Enzymes [BR:ced01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     LH89_06185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AIR68817
Position
complement(1424566..1425354)
Genome map
AA seq 262 aa AA seqDB search
MKVALGQFAVQRLWQDNAQTCITLMAQAASAGADLLVLPEAVLARDNTDPEWGVGCAQPI
TGPFVSQLLTASQSLDISVVFTLHTPAADGRVHNTLLVIRRGEVLVHYHKLHLYDAFTVQ
ESRRVTPGTALPPVVEVAGMRVGLMVCYDIRFAEMARQLAVNGADVLVVPAAWVKGPQKE
AHWELLARTRALENTCYLVATGECSDRNIGNSMVVDPMGVVIAQAAEQPELLLAELKLER
IQAVRHQLPVLHHNRFRPPVLR
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtggcgctcggtcagtttgccgtgcaacgtctatggcaggacaacgcccagacg
tgcataacattaatggcccaggcggcgtccgccggggctgatctgctggtgctgccggag
gcggtgctggcgcgagacaacacggacccggaatggggcgtcggttgcgcccagccgatc
accggcccgtttgtcagccagttactgaccgccagccagtcgctggatatcagcgtggtg
tttaccctgcatactccggcggcggatggacgtgtgcataatacgctgctggttatccgg
cgaggcgaagtgttggttcattaccacaagctgcatttgtatgacgcttttacggtgcag
gagtctcgacgggtgacgccgggtacggctctgccgccggtggtggaggtggcgggaatg
cgtgtcgggctaatggtgtgctacgacatccgtttcgccgagatggcgcgccaactggcg
gtcaacggtgccgatgtattggtggtgccggccgcctgggtgaaaggcccgcagaaggaa
gcgcactgggaattgctggcccggacccgggcgctggagaacacctgttatctggtggcg
acaggggagtgtagcgacaggaatatcggcaatagcatggtggtggacccgatgggcgtg
gttatcgcccaggctgccgaacagcctgaattgctgctggcggaactgaagctagagcgt
attcaagctgttcgtcaccagttacctgtgctgcatcacaaccgttttaggccgcctgta
ctacgatag

DBGET integrated database retrieval system