KEGG   Dickeya solani ND14b: LH89_10365Help
Entry
LH89_10365        CDS       T03347                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
ced  Dickeya solani ND14b
Pathway
ced00052  Galactose metabolism
ced00500  Starch and sucrose metabolism
ced01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ced00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    LH89_10365
   00500 Starch and sucrose metabolism
    LH89_10365
Enzymes [BR:ced01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     LH89_10365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AIR69589
Position
2368954..2370366
Genome map
AA seq 470 aa AA seqDB search
MKEIHLLKRMAYALMSGPSRQTYDPHRPQWHLSPLVGLLNDPNGFVQHKGRYHLFYQWNP
QACAHGAKFWGHWSSADLVHWRHEPVALVPSESYESHGCYSGSAVVDNDALALIYTGNVK
YDDGSRTAYQCLARANDDGEFDKVGPVLSLPEGYTGHVRDPKVWRHQDNWYMVLGAQDVD
LQGKVLLYRSSDLLQWHSLGEIAGSRLNGLGDFGYMWECPDLFALENHEVLICCPQGLPA
EEERYLNTHQSGYFIGSLDYDNGSFPHQAFHELDLGFEFYAPQTTQSEDGRRLLFGWMGV
PDQDEFFQPTITHGWIHTMTCPRELTLRDDRIYQQPARELQSLRHLEHLWQGVANYAPAL
PASSAELMLDTQGEFQINFAGVMVLCWDGERLTLSRRNRRTNEPEHRYWHDGPLHHLQIL
CDRSSVEIFINHGQAVMSSRYFPTSDAMVSFSGSGRITLQHWLLAPCVIE
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaatccatctgttaaaacgcatggcctacgccctgatgtccggaccgtcacgg
caaacctatgacccgcatcgtccgcagtggcacctgtcgccgctggtcgggctgctgaac
gatccgaatgggttcgtgcagcataaggggcgttaccatctgttttatcagtggaatccg
caggcctgcgcccacggcgccaagttctgggggcactggagctccgccgatctggtgcac
tggcgtcacgaaccggtggcgctggtgccatcagaaagctatgaaagccacggctgctac
tctggctccgccgtggtggataacgacgccctggcgctgatttataccggcaacgtgaaa
tacgacgatggctcacgcaccgcgtatcagtgcctggcgcgcgccaacgacgacggcgaa
ttcgacaaggtcggcccggtgctgtcattgccggaagggtacactggccacgtccgcgac
ccgaaggtctggcgtcatcaggacaactggtacatggtactgggcgcacaggatgtggat
ttacagggcaaagtgctgctgtatcggtcatccgacctgctgcaatggcattctctgggt
gaaatcgccggctcccgcctcaacgggctgggcgatttcggttacatgtgggaatgcccg
gacctgttcgcactagaaaaccatgaggtgttgatctgctgtccgcaagggctgcctgcc
gaagaagagcgctacctgaatacccatcagtccggttatttcatcggctcgctcgactac
gacaacggcagtttcccccatcaggcgttccacgaactggatctgggcttcgaattttac
gcgccgcaaaccacacagagcgaagatggccgccgtctgctgttcggctggatgggcgtg
ccggatcaggacgaattctttcaaccgacaatcacgcacggctggatccataccatgacc
tgcccgcgcgaactgacgctgcgcgatgatcggatttatcagcaaccggcgcgcgagctg
caaagcctgcgtcatctggaacatctgtggcagggcgtcgctaactacgcgcccgctctg
cccgccagcagcgcggaactcatgctggacacacagggtgaatttcagatcaacttcgcc
ggggtgatggtgctgtgctgggacggcgaacgcctgaccctgagccgtcgcaatcgccgc
accaacgagccggaacaccgttactggcatgacggcccgctgcaccacttgcagattctg
tgcgaccgctccagcgtggaaatttttatcaaccacgggcaggcggtgatgtcatcacgc
tatttccccaccagcgacgccatggtcagcttcagcggctcgggtcgcatcacgttgcaa
cactggctgttggcaccgtgcgtgatagaataa

DBGET integrated database retrieval system