KEGG   Dickeya solani ND14b: LH89_11915Help
Entry
LH89_11915        CDS       T03347                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
ced  Dickeya solani ND14b
Pathway
ced00051  Fructose and mannose metabolism
ced01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ced00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    LH89_11915
Enzymes [BR:ced01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     LH89_11915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh ApbA 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AIR69875
Position
complement(2698185..2699333)
Genome map
AA seq 382 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADAGISLTFADVNQPLLDAINQRGSYPVRIVGEQQQVDTV
SQVSAVHSGSPQAVELIAGVDLVTTAVGPQILAKIAGAIAQGLVKRHANGNTSPLNIIAC
ENMVRGTSQLKQHVLAQLPENTQAWVAQHVGFVDSAVDRIVPPAEAGESDPLAVTVETFS
EWIVDKTQFNGEPPAIAGMELTDNLMAFVERKLFTLNTGHAITAYLGQRAGHSTIRDAIL
DPAIRRVVQGAMEESGAVLIRRYGFDADKHQAYIRKILTRFENPWLHDEVERVGRQPLRK
LSAGDRLIKPLLGTLEYSLPHDNLIQGIAAAMHYRSEQDPQAQELAALIVSQGPKVALAQ
ISGLDADSEVVGKAVSVYNAMQ
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacattttggggccggcaatatcggccgtgggtttatcggcaagctgctg
gcggacgcgggcatttccctgacgtttgccgatgtgaaccagccgttgctggatgccatc
aatcaacgcggtagctatccggttcggatcgtcggcgaacagcagcaggtagatacggtc
agtcaggtcagcgccgtacacagcggcagcccgcaggcggttgagttgattgccggggtt
gacctggtgacaacggccgtgggtccgcagattctggcgaagatcgccggcgctattgct
caggggctggtgaaacgccatgccaacggcaacacctcgccgctgaatattatcgcctgc
gaaaacatggtgcgcggcaccagccagctcaaacagcatgtgctggcgcaattgccggaa
aatacgcaggcgtgggtcgcgcagcatgtcggtttcgtggactcggcggtggaccgtatt
gtgccgccggctgaagccggcgagtccgatccgctggcggtgacggtggaaacgttcagc
gaatggattgtggataaaacccagttcaacggcgagccgccggcgatcgccggtatggaa
ctcactgataacctgatggcgttcgttgagcgcaagctgttcaccctgaacaccggtcat
gccatcaccgcttacctcggccagcgcgctgggcacagcaccatccgcgacgccattctg
gacccggcgatccgccgcgtggtgcagggggcgatggaagagagcggcgcggtgctgatt
cgtcgctatggttttgatgccgacaagcatcaggcttacatccgtaaaattcttacccgt
tttgaaaacccgtggctgcacgatgaggtggagcgcgtcggccgtcagccgctgcgtaaa
ctcagcgctggcgatcgcctgatcaaaccgttgctgggcacgctggaatacagcctgccg
catgacaacctgatccagggcattgccgccgcgatgcattatcgcagcgagcaggacccg
caggcgcaggaactggcggcgttgatcgtctcgcaagggccgaaggttgcgctggcgcag
atttccggtctggacgctgacagcgaggttgtcggaaaagcggtgagtgtgtataacgcc
atgcagtaa

DBGET integrated database retrieval system