KEGG   Dickeya solani ND14b: LH89_20695Help
Entry
LH89_20695        CDS       T03347                                 

Definition
(GenBank) chemotaxis protein CheA
  KO
K03407  two-component system, chemotaxis family, sensor kinase CheA [EC:2.7.13.3]
Organism
ced  Dickeya solani ND14b
Pathway
ced02020  Two-component system
ced02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ced00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LH89_20695
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    LH89_20695
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ced01001]
    LH89_20695
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ced02022]
    LH89_20695
   02035 Bacterial motility proteins [BR:ced02035]
    LH89_20695
Enzymes [BR:ced01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     LH89_20695
Protein kinases [BR:ced01001]
 Histidine kinases
  CheA family [OT]
   LH89_20695
Two-component system [BR:ced02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   LH89_20695
Bacterial motility proteins [BR:ced02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    LH89_20695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheW CheY-binding Hpt H-kinase_dim HATPase_c DUF4265 HATPase_c_3
Motif
Other DBs
NCBI-ProteinID: AIR71505
Position
4630933..4632966
Genome map
AA seq 677 aa AA seqDB search
MDMSAFYQTFFDEADELLADMEQHLLQLDPLAPDTEQMNAIFRAAHSIKGGAGTFGFTVL
QETTHILENLLDGARRGEMRLSTDIINLFLETKDIMQDQLDAYKTSQEPNAESFEYICQA
LRQLALESKDDGAAGAASVKVNAEQPVSASPTPASAGGHSGLRIALTNLKESDIPQLLEE
LGNLGTVKDTAQTSNSVELTLETSASEDDISAVLCFVLEPDQINFKSAAEAAPADAAPPV
AAVVEPTEAAPVAPVQPAAPVAAAPAAKPAGGNDAAKGRQKAGDTSIRVAVEKVDQLINL
VGELVITQSMLAQRSSALDPVAHGDLLNSMGQLERNARDLQESVMSIRMMPMEYVFSRFP
RLVRDLAAKLGKEVELTQLGSSTELDKSLIERIIDPLTHLVRNSLDHGIESPEKRIEAGK
SAVGNLTLSAEHQGGNICIEVIDDGAGLNRERILAKALSQGMAVSDSMTDEEVGMLIFAP
GFSTAEKVTDVSGRGVGMDVVKRNIQEMGGHVEIHFVKGKGTTIRILLPLTLAILDGMSV
KVNSDVFILPLNAVMESLQPQAEDLYPLAGGERVLQVRGEYLPLVELYQVFDVAGAKTDA
TQGIVVILQSAGRRYALLVDQLIGQHQVVVKNLESNYRKVPGVSAATILGDGSVALIVDV
SALQALYREKRVVETAA
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atggacatgagtgctttttatcaaacattctttgatgaagcagatgaattgttggcggac
atggagcaacatttattgcaacttgatccgttagcgcccgatacggaacagatgaatgcc
atatttcgcgctgctcactcgattaaagggggcgcgggaacgttcggtttcacggtattg
caggaaaccacacacatattagaaaacctgttggatggtgccagacgcggtgaaatgcga
ttgagcactgatattatcaacctgtttttggaaaccaaagatatcatgcaggatcagttg
gatgcttataaaacctcgcaagagcccaacgccgaaagctttgagtatatctgtcaggct
ctgcgccagcttgctctggagtccaaagatgatggtgctgccggagcggcctctgtcaag
gtaaatgctgaacaaccggtttccgcgtcccctacaccggcttccgccggcggtcattcg
ggattgcgtattgcccttaccaacctgaaagagtcagatattcctcagttgcttgaagag
ttggggaatctgggtacggtaaaagatacggcgcagaccagcaatagtgttgagttaacg
ctggaaacgtcagccagcgaagatgacatcagcgctgtgctgtgttttgtgctggagccg
gaccaaatcaacttcaaatctgctgctgaggcagcgccagccgacgctgctccgccagtt
gctgcggtggtcgagccgactgaggctgcgccagttgcccccgttcagcctgctgcgcca
gtggcggctgcaccggcggccaagcctgcaggcggcaatgatgcagccaaaggcagacaa
aaagccggtgacaccagtatccgtgtagcggtggaaaaagttgaccagctcattaacctg
gttggtgaactggtgattactcaatccatgctggctcagcgttccagcgctctggacccg
gtcgctcatggcgacctgcttaatagcatggggcagttggaaagaaacgcgcgtgacctg
caagagtccgtgatgtcgatccgtatgatgccgatggaatatgtattcagccgtttcccg
cgtctggttcgcgacctggccgccaagctgggcaaagaagttgaactgacccagttggga
agttcaaccgagctggataagagcctgatcgaacgtattattgacccgttgacgcacctt
gtacgtaacagtctggaccatggtatcgagtcaccggaaaaacgtattgaagcgggcaaa
tcggctgtcggaaacctgacgttgtctgcggaacatcagggcggcaatatctgtatcgaa
gtgattgacgacggtgcgggtctgaatcgcgagcgtatcctggccaaagccctgtcccag
gggatggcggtgagcgatagcatgactgacgaagaagtcggtatgctgatttttgctccc
ggtttttctactgccgagaaagtgaccgatgtgtcaggtcgtggcgttggcatggatgtg
gtgaaacgaaatatccaggagatgggtgggcatgttgaaattcatttcgtgaaaggtaag
ggaaccaccatccgcattcttctgccgttgacgctggcgatcctggatggcatgtcggtc
aaggtcaatagtgatgtatttatcctgccgcttaacgcggttatggagtctctgcagccg
caggccgaggatttgtatcctctggctgggggagagcgtgtgctgcaggtccgtggcgaa
tatctgccactggttgagctgtatcaggtattcgatgtcgccggagcaaaaacggatgcc
actcagggtatcgttgttatcctgcagagtgccggccgtcgttatgccttgctggttgac
cagttgattggtcagcatcaggttgttgtgaagaacctggaaagcaattatcgcaaggta
ccaggcgtttcagccgcaactattttgggtgatggtagcgtagcgctgattgtggatgtt
tctgcgttgcaggcgctttatcgggaaaagcgtgtggttgaaaccgcagcttaa

DBGET integrated database retrieval system