KEGG   Corynebacterium efficiens: CE0827
Entry
CE0827            CDS       T00103                                 
Name
(GenBank) hypothetical protein
Organism
cef  Corynebacterium efficiens
SSDB
Motif
Pfam: HTH_17 MerR MerR_1 Xre-like-HTH RWP-RK BEN
Other DBs
NCBI-ProteinID: BAC17637
NITE: CE0827
UniProt: Q8FRD4
Position
880015..880233
AA seq 72 aa
MTTPSRHLTTEEACDLLRVDASTLRRYAREGKFSRIRLSPRKVLYIRDEIEAYIDARTIH
AQPLAGKRRAGR
NT seq 219 nt   +upstreamnt  +downstreamnt
atgaccaccccatcacgtcacctgacaaccgaagaggcctgtgacctcctgcgtgttgat
gcctccaccttgaggcggtacgcccgtgaggggaagttctcccggatccggcttagccct
cggaaggtgctctacatccgggatgagatcgaggcgtacatcgatgcccgcaccatccat
gcgcagcccctggcggggaagcggagggccggtcgatga

DBGET integrated database retrieval system