KEGG   Corynebacterium efficiens: CE0837
Entry
CE0837            CDS       T00103                                 
Name
(GenBank) hypothetical protein
Organism
cef  Corynebacterium efficiens
SSDB
Motif
Pfam: CxC4
Other DBs
NCBI-ProteinID: BAC17647
NITE: CE0837
UniProt: Q8FRC4
Position
885062..886327
AA seq 421 aa
MAWLRIGDNVATHPKMSLLLEACEFDHSLKNESFGLMVSLAAVSAAHLTDFMVGPGLVAQ
FAPGREKVLIDILVSAGLLERVKVDERWMYKLYNDEEFIHMRTKAEVEIDRARKRDSRRH
DLIIPVRVRDGDQCRWCGKTVSWEDRKSARAATIDSLTSHRESTVETLVVACNGCNSAGH
EGKERTPRPAPTPQEVYYSPKTIAWINNTDYAQENGIHLTDRQTRLDIPAAPAATTVKAA
AHSAAPGGGSAGMAADSPQESSAHVAAAPERCGAPTADHSTAAAYGAAPDRYRNQAAAGQ
DPWEDAPDWVTQPAEKVLGRATAPGGGSVGMAADSPQESSAHVAATPEGRGAPTADHPTA
AAPPGALPKGNDSVKPRPDLDQVGDRPGLSGSGRVGSDRAGQVSVSGSRRRRGRRGGKRK
S
NT seq 1266 nt   +upstreamnt  +downstreamnt
atggcatggctgcgcatcggcgacaacgtcgccacgcacccgaagatgtctctcctcctc
gaggcatgcgaattcgaccactccctgaaaaatgaatcctttggactcatggtctccctc
gccgcggtctcagcagcccacctcaccgacttcatggtcggccccggcctcgtcgcacag
ttcgcgccgggcagagagaaggtgctgatcgatatcctcgtctccgccgggctcctggag
cgcgtcaaagtggacgagcggtggatgtacaagctgtataacgatgaagagttcatccac
atgcgcaccaaagcggaagtggaaatcgaccgggctcgcaagcgcgacagccgacgccac
gacctaatcattcccgtcagggtccgcgacggcgaccagtgccgctggtgcggcaagacg
gtgtcctgggaggaccggaaatctgctcgcgcggccaccattgacagcctcaccagtcac
cgcgagagtaccgtcgagaccctcgtcgtggcctgcaatggttgcaactcagccggccat
gaaggcaaggaacgcacaccccgcccagcacccacaccccaggaggtctactactcacca
aagacaatcgcgtggatcaacaacaccgactacgcgcaagaaaacggtattcacctaacc
gatcggcagactcgcctggacatcccagcagcgccggcagcaaccacggtcaaggcagca
gcacatagcgcagcgccgggaggtggatcagcaggtatggcagcagacagtcctcaggag
agcagcgcccatgtggcagcagcgcctgaacgatgtggagcgccgacagctgatcactcc
acggcagcagcatatggagcagcgccagaccgctatcgcaaccaggcagcagcgggacaa
gacccatgggaggacgccccggactgggtgacgcaaccggcagagaaggttctcggcagg
gcaaccgcgccaggaggtggatcagtaggtatggcagcagacagtcctcaggagagcagc
gcccatgtggcagcaacgcctgagggacgtggagcgccgacagctgatcaccccacggca
gcggcgccgccgggcgccctacccaaaggtaacgattcggtaaaacctagaccggatcta
gatcaggtgggtgacagacctggattgtccgggtcgggacgggtcgggtcggatagggca
ggacaggtgtcggtttctggttctcgccgtaggagaggccgtcgtggaggaaagcggaag
tcgtaa

DBGET integrated database retrieval system