KEGG   Corynebacterium efficiens: CE0460Help
Entry
CE0460            CDS       T00103                                 

Definition
(GenBank) putative glutamate-1-semialdehyde 2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
cef  Corynebacterium efficiens
Pathway
cef00860  Porphyrin and chlorophyll metabolism
cef01100  Metabolic pathways
cef01110  Biosynthesis of secondary metabolites
cef01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cef00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CE0460
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cef01007]
    CE0460
Enzymes [BR:cef01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     CE0460
Amino acid related enzymes [BR:cef01007]
 Aminotransferase (transaminase)
  Class III
   CE0460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: BAC17270
NITE: CE0460
UniProt: Q8FSD4
Position
498556..499884
Genome map
AA seq 442 aa AA seqDB search
MVDMSASPSGTSANVSRSIEWFEKAKMFTPGGVNSPVRAFGSVGGQARFIDRAHGSTLID
VDGNEYVDLVCSWGPMLMGHAHPAVLEAVQKTIVDGLSFGAPTIGEVELAQDIINRTSVE
EVRLVNSGTEATMSAVRLARGYTQRPKILKFDGCYHGHVDSLLASAGSGVATFALPDSPG
ITGAQTRDTIVVPYNDIEAVRAAFAEFPGQIACIISEAAAGNMGTVAPQDHFNEHLLAIA
HADGALLILDEVMTGFRTSYRGWFGVDKVRADLVTFGKVVSGGLPAAAFGGRAEIMNMLA
PQGPVYQAGTLSGNPVAVAAGRASLSAATEEVYRTIDANADRLHGLISDALTREGVAHHI
QRASNMLSIRFAEGEGHNFTDMKNADTFRFAPFFHALLDHGVYAPPSVFETWFVSSALTD
DDFQKIDDALVPAARAAAAATA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggttgatatgtctgcttccccgtcgggtacttccgccaacgtctcccgttccatcgag
tggtttgaaaaagccaagatgttcaccccgggaggtgtgaattcgccggtgcgggccttc
ggctccgtcggtggtcaggcccggttcatcgaccgggcacatggctccaccctcatcgac
gtcgacggcaacgagtacgtcgacctggtctgctcctggggccccatgctcatgggacac
gcccacccggccgtgctggaggcggtgcagaaaaccatcgtcgacggcctgtccttcggt
gcccccaccatcggtgaggtggaactggcgcaggacatcatcaaccgcacctccgtggag
gaggtccgcctggtcaactccggcaccgaggccaccatgtccgcggtccgcctggcccgc
ggttacacgcagcgccccaagatcctgaagttcgacggctgctaccacggtcacgtggat
tccctgctggcctccgccggttccggtgtggccaccttcgccctgccggactccccgggt
atcaccggtgcgcagacccgcgacaccatcgtggtgccctacaacgacatcgaggccgtg
cgcgccgccttcgccgagttccccggccagatcgcctgcatcatctccgaggcggccgcc
ggcaacatgggcaccgtcgcaccgcaggaccacttcaatgagcacctgctggccatcgcg
catgccgacggcgcactgctcatcctcgatgaggtcatgaccggtttccgcacctcctac
cgcggctggttcggtgtggacaaggtccgcgccgacctggtcaccttcggcaaggtcgtc
tccggcggtctgccggccgccgccttcggtggtcgcgccgagatcatgaacatgctggcc
ccgcagggtcccgtctaccaggccggcaccctgtccggtaatccggtggctgtggcggcg
ggccgggcgtcgttaagcgctgcgaccgaggaggtctaccgcaccatcgacgccaacgcc
gaccgcctgcacggcctgatctccgacgcgctcacccgcgagggtgtggcgcaccacatc
cagcgcgcctccaacatgctgtccatccggttcgccgagggggaggggcacaacttcacc
gacatgaagaacgccgacaccttccggttcgcaccgttcttccacgcactgctcgatcac
ggcgtctacgccccaccgagtgtgttcgagacctggtttgtgtcctcggccctgacggac
gatgatttccagaagatcgacgatgccctggttcctgctgcccgcgcggccgcagctgcc
accgcataa

DBGET integrated database retrieval system