KEGG   Corynebacterium efficiens: CE0731Help
Entry
CE0731            CDS       T00103                                 

Definition
(GenBank) putative acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cef  Corynebacterium efficiens
Pathway
cef00071  Fatty acid degradation
cef00072  Synthesis and degradation of ketone bodies
cef00280  Valine, leucine and isoleucine degradation
cef00310  Lysine degradation
cef00362  Benzoate degradation
cef00380  Tryptophan metabolism
cef00620  Pyruvate metabolism
cef00630  Glyoxylate and dicarboxylate metabolism
cef00640  Propanoate metabolism
cef00650  Butanoate metabolism
cef00900  Terpenoid backbone biosynthesis
cef01100  Metabolic pathways
cef01110  Biosynthesis of secondary metabolites
cef01120  Microbial metabolism in diverse environments
cef01130  Biosynthesis of antibiotics
cef01200  Carbon metabolism
cef01212  Fatty acid metabolism
cef02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cef00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CE0731
   00630 Glyoxylate and dicarboxylate metabolism
    CE0731
   00640 Propanoate metabolism
    CE0731
   00650 Butanoate metabolism
    CE0731
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CE0731
   00072 Synthesis and degradation of ketone bodies
    CE0731
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CE0731
   00310 Lysine degradation
    CE0731
   00380 Tryptophan metabolism
    CE0731
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CE0731
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CE0731
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CE0731
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cef04147]
    CE0731
Enzymes [BR:cef01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CE0731
Exosome [BR:cef04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CE0731
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAC17541
NITE: CE0731
UniProt: Q8FRM9
Position
complement(786155..787363)
Genome map
AA seq 402 aa AA seqDB search
MTTSSKTPNDPSDIVILGARRTPQGKLLGQLSTLTATQLGGRAIAAALESAGVRPDQVDQ
VIMGQVVQSDAGQNPARQAAVEAGIGLDVPAVTVNSVCLSGLRAITDAARLLRLGEAEVV
VAGGQESMSGAPHLLPGARRGVAYGSVTAVDSLERDALTDAFDQRSMGVNTDEGNGQFTI
SREQQDEVAALSHQRAAAAWEEGAFDAEITPVEVTVRKKGTITIDRDEGIRPETTVDSLA
GLRPAFTPDGSITAGNSSPISDGAAATVLSTRAFAEAHGLEPLATIVGWANTAGPDTLLH
AQPARATRAVLERAGWSTGDLDFLEINEAFGAVAVESLRELDYPLERTNIHGGAIALGHP
VGTSGARIVVHAAHELARRGGGRAAVSICGGGGQGDALLLAR
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgactacatcttccaagacacccaatgacccatccgacatcgtcatcctcggcgcccgg
cgaacaccccaggggaaactgctcggccagctctccacactgaccgccacccagctgggt
gggcgtgccatcgctgcggcactggaatccgccggtgtccggcccgatcaggtggaccag
gtgatcatgggccaggtggtgcagtcggatgccggacagaacccggcgcgccaggccgcc
gtcgaggccggtatcggcctggatgtcccagcggtgacggtcaacagcgtgtgcctgtcg
gggctgcgcgccatcaccgacgcagcacgtctcctccgcctcggtgaggccgaggtggtg
gtcgccggtgggcaggagtccatgtccggtgccccgcatctgctgcccggtgcccgccgg
ggtgtggcctacggttccgtcaccgcggtggattccctggagcgcgacgcactcaccgat
gccttcgatcagcgttcgatgggtgtcaacaccgatgagggtaatggccagttcaccatc
tcccgtgagcaacaggatgaggtcgccgcattatcgcatcagcgcgcggcggccgcctgg
gaggaaggcgccttcgatgccgagatcaccccggtggaggtgacggtgcgaaagaagggc
accatcaccatcgaccgtgatgagggcatccgtcccgagaccaccgtggacagcctcgcc
gggctgcgccccgccttcaccccggatggttccatcaccgcgggcaactcctcccccatc
tccgatggtgcggcggccaccgtgctgagcacccgggccttcgccgaggcgcacggtctg
gaaccactggccaccatcgtggggtgggccaacaccgcgggacccgataccctcttgcac
gcccagcccgcacgcgccacccgggcggtcctggaacgcgcaggctggagcaccggggac
ctggacttcctggagatcaacgaggccttcggtgcggtggccgtggaatccctgcgtgag
ctggactaccccctcgagcgcaccaacatccacggtggcgccatcgcccttggacatccg
gtggggacatccggtgcccgcatcgtggtgcatgcggcgcatgaactcgcccggcgtggc
gggggacgtgccgcggtgtccatctgcggtggcggcggccagggtgatgcgcttctgctc
gcccgctga

DBGET integrated database retrieval system