KEGG   Corynebacterium efficiens: CE0956Help
Entry
CE0956            CDS       T00103                                 

Definition
(GenBank) putative UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cef  Corynebacterium efficiens
Pathway
cef00040  Pentose and glucuronate interconversions
cef00052  Galactose metabolism
cef00500  Starch and sucrose metabolism
cef00520  Amino sugar and nucleotide sugar metabolism
cef01100  Metabolic pathways
cef01130  Biosynthesis of antibiotics
Module
cef_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cef00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CE0956
   00052 Galactose metabolism
    CE0956
   00500 Starch and sucrose metabolism
    CE0956
   00520 Amino sugar and nucleotide sugar metabolism
    CE0956
Enzymes [BR:cef01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CE0956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: BAC17766
NITE: CE0956
UniProt: Q8FR11
Position
1014869..1015924
Genome map
AA seq 351 aa AA seqDB search
MQLVPQLLFALAHGLKDIPYFRWGTGFGQTPAGRVVSMSLSIKEHVNAVKTVVVPAAGMG
TRFLPATKTVPKELLPVVDTPGIELIAEEAAKLGATRLAVITAPNKAGVLAHFERFTELE
ATLEERGKTDQLQKVRRAAGLIDAVPVTQEHPLGLGHAVGLAESVLDADEDVVAVMLPDD
LVLPFGVMERMAQVRAEFGGSVLCAVEVADDEVSNYGIFRVENADDNGADQDVKRVTGMV
EKPAVEDAPSNLAATGRYLLDRSIFDALRRITPGAGGELQLTDAIALLIDDGHPVHIVVH
RGKRHDLGNPGGYIPACVDFGLDHPVYGPQLRRALAQIMVDHGVVDASAIR
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
ttgcagcttgtcccgcagcttctgtttgctctcgctcatggtttaaaggatatcccttat
ttccggtggggcacggggtttggccagacgcctgcaggtagggtggtgtccatgagtctg
tctatcaaagagcatgtgaacgcggtcaagactgtcgtggtgcctgccgctggaatgggg
acgcgctttctccccgccacgaagacggttcccaaggaactgctcccggttgtggatacc
cctggcatcgagttgatcgcggaggaggccgccaagttgggggccacccgcctggcggtt
atcaccgcacccaacaaggcaggggtgctcgcgcattttgagcggttcaccgagctggag
gccaccctggaggagcggggaaagacagaccagttgcagaaggtccgtcgtgcggcgggg
ctcatcgacgctgttcccgtcactcaggagcaccccctcggactggggcacgctgtggga
ctggctgagtccgtgctcgatgcggatgaggatgtcgttgcggtcatgctgcccgatgat
ctcgtgctgccgttcggggtcatggaacgcatggcgcaggtacgtgcggagttcggtggt
tccgtcctgtgtgccgtcgaggttgctgatgatgaggtgagcaactacggcatcttccgg
gtggagaacgctgatgataatggtgctgaccaggatgtcaagcgggtgaccgggatggtg
gagaagccggctgttgaggatgccccctccaacctcgcggccaccggccgttaccttctt
gaccggtccatcttcgacgccctgcggcgtatcacccccggtgccggtggggagctgcag
ctgaccgatgccatcgccctgcttatcgacgacgggcacccggttcacatcgtcgtccac
cgtggtaaacgacacgatctcggcaaccccggtggttatatcccggcatgcgtcgacttt
ggtctggaccatcccgtgtacggtccccagcttcgtcgcgcactcgcccagatcatggtg
gatcatggcgtggtcgatgcctccgccatcaggtga

DBGET integrated database retrieval system