KEGG   Corynebacterium efficiens: CE1046Help
Entry
CE1046            CDS       T00103                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01524  exopolyphosphatase / guanosine-5'-triphosphate,3'-diphosphate pyrophosphatase [EC:3.6.1.11 3.6.1.40]
Organism
cef  Corynebacterium efficiens
Pathway
cef00230  Purine metabolism
cef01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cef00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CE1046
Enzymes [BR:cef01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.11  exopolyphosphatase
     CE1046
    3.6.1.40  guanosine-5'-triphosphate,3'-diphosphate phosphatase
     CE1046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ppx-GppA DDR FtsA DUF993
Motif
Other DBs
NCBI-ProteinID: BAC17856
NITE: CE1046
UniProt: Q8FQS3
Position
1104019..1104990
Genome map
AA seq 323 aa AA seqDB search
MMTRFAAVDCGTNSIRLLITEVTADVFREITRENRIVRLGQGVDATGELDPEAIERTRVA
LTEYVELMEAEGVQVVRMVATAATRDAANRDAFFSMTRVLLSRIRPGYQAEVITGEEEAQ
LSFRGAVADLDPAQGPFCVIDLGGGSTEFIVGTHDGEILGSHSAQMGCVRLTERIMRSDP
PTATEVEIARDYVSERIAEVSAIVPISRANTFVGVAGTFTTISAWVQGLESYDRAAIHLS
ELNFDALRVVTDEIIRESAAQRAGNPVVDPGRADVIAGGSVVVQGAIDLAAREAGVNSIV
ISEKDILDGLILGLVEEYGTVAP
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtgatgacccgtttcgccgcggtggattgtggcaccaactccatccgcctgctcatcacg
gaggtgaccgcggatgttttccgggagatcacccgcgagaacaggatcgtgcgcctgggc
cagggcgtggatgccaccggtgaactagatccggaggccatcgaacgcacccgcgtcgca
ctgaccgagtacgtcgaactcatggaggccgaaggtgtgcaggtggtgcgcatggtggcc
accgccgccacccgtgacgccgccaaccgcgatgcgttcttctccatgacccgcgtcctg
ctctcacgcatccgccccggataccaggcggaggtcatcaccggtgaggaggaggcgcag
ttgtccttccgtggtgcggtagccgatctggaccccgcacaggggccattctgcgtcatt
gatctgggcggtgggtccacggaattcatcgtggggacccacgacggtgagatcctcggc
tcccactccgcacagatgggctgtgtccgcctgaccgaacgcatcatgcgcagtgatccc
cccaccgccacggaggtcgagatcgcccgcgattatgtctccgagcggatcgcggaggtc
agcgccatcgtgccgatctcccgcgccaacaccttcgtgggggtggccggtaccttcacc
accatctcggcctgggtgcaggggctggaatcctatgaccgtgcggccattcacctctcg
gagttgaacttcgacgccctgcgcgtggtcaccgatgagatcatccgcgaatccgctgca
cagcgcgccggcaacccggtggtggatccggggcgcgccgatgtcatcgccggtgggtcc
gtggtggtccagggagccatcgacctggctgcccgtgaggcgggggtcaactccattgtc
atctcggagaaggacatcctcgatggtctcatcctgggcctggtggaggaatacggcacc
gtggcaccctaa

DBGET integrated database retrieval system