KEGG   Corynebacterium efficiens: CE1803Help
Entry
CE1803            CDS       T00103                                 

Definition
(GenBank) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
cef  Corynebacterium efficiens
Pathway
cef00010  Glycolysis / Gluconeogenesis
cef00520  Amino sugar and nucleotide sugar metabolism
cef01100  Metabolic pathways
cef01110  Biosynthesis of secondary metabolites
cef01120  Microbial metabolism in diverse environments
cef01130  Biosynthesis of antibiotics
cef01200  Carbon metabolism
Module
cef_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cef00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CE1803
   00520 Amino sugar and nucleotide sugar metabolism
    CE1803
Enzymes [BR:cef01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     CE1803
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK DUF2625
Motif
Other DBs
NCBI-ProteinID: BAC18613
NITE: CE1803
UniProt: Q8FPH5
Position
1900488..1901297
Genome map
AA seq 269 aa AA seqDB search
MTSAAVFLPDSLLVCTLGRMTETGFGIDIGGSGIKGARVDLSTGEFIGDRIKISTPKPAT
PDAVAEVVTEILAEAQWDGPVGITVPAVVRGQVALTAANIDKAWIGTDVHELFHRHLGDR
EITVLNDADAAGIAEATFGHPDARKRSVILLTFGTGIGSAFLMDGELFPNTELGHLIVDD
MEAEHRASGAVKDNKDLSWKEWAAEVSRVLNEYERLFYPSLFIVGGGISRKHKKWVPLLD
VKTEVVPAELRNRAGIVGAAMAVAKHLAP
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgacctctgcagctgttttcctgccggattccctgttggtttgtacacttgggcgcatg
actgaaacgggatttggaatcgatattggtggttccggcatcaagggtgcacgggtcgac
ctgtccaccggtgagttcatcggcgatcggataaagatctccacccccaagcccgcaacg
cctgacgccgtcgctgaggtggtcacagagatcctcgcggaagcgcagtgggatggaccg
gtgggcatcacggttcccgccgtggtgcgtggacaggtggcgctcactgccgccaacatc
gataaggcgtggattggcacggatgtccacgagctgttccaccggcacctgggtgatcgg
gagatcaccgtgctcaacgatgcggatgcagcgggcatcgccgaagccacgttcgggcac
cccgatgcacgcaagagatcagtcatcctcctgaccttcggaaccggtatcggatcagct
tttctcatggatggtgagcttttccccaacacagagctgggacatctcattgtcgatgac
atggaagcagagcaccgcgcctccggggctgtcaaggacaacaaggacctctcctggaag
gagtgggccgctgaggtcagcagggtactcaacgagtatgagcgcctcttctaccccagt
ttgttcatcgtgggcggtgggatctcccggaaacataagaagtgggttccactcctcgat
gtcaaaacggaggtcgttccggcggagctgcgtaatcgcgcgggtatcgtcggggcggcg
atggcggtggcaaaacacctggccccctag

DBGET integrated database retrieval system